KEGG   Saccharomyces cerevisiae (budding yeast): YIL109CHelp
Entry
YIL109C           CDS       T00005                                 

Gene name
SEC24, ANU1
Definition
(RefSeq) COPII subunit SEC24
  KO
K14007  protein transport protein SEC24
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YIL109C (SEC24)
Membrane trafficking [BR:sce04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    YIL109C (SEC24)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sec23_trunk Sec23_helical zf-Sec23_Sec24 Sec23_BS Gelsolin
Motif
Other DBs
NCBI-GeneID: 854697
NCBI-ProteinID: NP_012157
SGD: S000001371
UniProt: P40482
Structure
PDB: 

Position
IX:complement(157385..160165)
Genome map
AA seq 926 aa AA seqDB search
MSHHKKRVYPQAQLQYGQNATPLQQPAQFMPPQDPAAAGMSYGQMGMPPQGAVPSMGQQQ
FLTPAQEQLHQQIDQATTSMNDMHLHNVPLVDPNAYMQPQVPVQMGTPLQQQQQPMAAPA
YGQPSAAMGQNMRPMNQLYPIDLLTELPPPITDLTLPPPPLVIPPERMLVPSELSNASPD
YIRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDGLIVRCRRCRSYMNP
FVTFIEQGRRWRCNFCRLANDVPMQMDQSDPNDPKSRYDRNEIKCAVMEYMAPKEYTLRQ
PPPATYCFLIDVSQSSIKSGLLATTINTLLQNLDSIPNHDERTRISILCVDNAIHYFKIP
LDSENNEESADQINMMDIADLEEPFLPRPNSMVVSLKACRQNIETLLTKIPQIFQSNLIT
NFALGPALKSAYHLIGGVGGKIIVVSGTLPNLGIGKLQRRNESGVVNTSKETAQLLSCQD
SFYKNFTIDCSKVQITVDLFLASEDYMDVASLSNLSRFTAGQTHFYPGFSGKNPNDIVKF
STEFAKHISMDFCMETVMRARGSTGLRMSRFYGHFFNRSSDLCAFSTMPRDQSYLFEVNV
DESIMADYCYVQVAVLLSLNNSQRRIRIITLAMPTTESLAEVYASADQLAIASFYNSKAV
EKALNSSLDDARVLINKSVQDILATYKKEIVVSNTAGGAPLRLCANLRMFPLLMHSLTKH
MAFRSGIVPSDHRASALNNLESLPLKYLIKNIYPDVYSLHDMADEAGLPVQTEDGEATGT
IVLPQPINATSSLFERYGLYLIDNGNELFLWMGGDAVPALVFDVFGTQDIFDIPIGKQEI
PVVENSEFNQRVRNIINQLRNHDDVITYQSLYIVRGASLSEPVNHASAREVATLRLWASS
TLVEDKILNNESYREFLQIMKARISK
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatcacaagaaacgtgtttacccacaagctcagctccagtatggacaaaatgcc
acccctctacaacagccagcacaattcatgcctccgcaggatcctgctgcagctggaatg
agctatggtcagatgggaatgccgccacagggtgcagtcccttccatggggcagcaacaa
ttcctaacccctgctcaagaacagttacaccagcaaattgatcaggccaccacttccatg
aacgatatgcatctgcacaacgtaccgctagtcgatcctaacgcttatatgcagccacag
gttcccgtgcaaatgggcacacctttgcagcaacagcaacaaccaatggcagcgcctgcg
tatggccaacctagcgccgcaatgggccaaaacatgaggcccatgaaccagttgtatcca
atcgatctgttgacggaattgcctcctccaattaccgatctgaccttgcctcccccaccg
ttggttattcctccagaaaggatgttagttccttctgaattgtccaatgcgtctccagat
tatatcaggtcgaccttgaacgccgttcctaagaacagctccctgctgaagaagtctaaa
cttccatttgggcttgttatcagaccataccaacacttgtacgacgatatcgacccgcct
ccattgaatgaagatggacttattgtccgttgtcgtcgttgtcgttcttacatgaaccct
tttgtcacttttatcgagcaaggcagaagatggagatgtaacttttgtcgtctggccaat
gacgttcctatgcaaatggaccagagcgatccaaacgacccaaagagtagatacgacaga
aatgaaatcaaatgtgctgtgatggaatatatggccccaaaggaatatactctaagacaa
ccacctccagccacttactgtttcctgatcgatgtctcccagtcctctatcaagagtggg
ttactggccactaccatcaacacccttttgcaaaatcttgattccattccaaaccatgat
gaaagaaccagaatttccatcttatgtgtagacaacgccattcactactttaaaatccca
ttggattctgaaaacaatgaagagtccgccgatcaaatcaacatgatggatattgccgac
ctggaagagcctttcttgcccagaccaaactctatggttgtgtccttaaaggcctgcaga
caaaacattgaaactttattgaccaagattcctcaaatcttccaatctaatttaatcaca
aatttcgcactgggccccgctttgaaatccgcttatcatttaattggtggcgttggtggt
aaaataattgttgtgtcaggtactttgcccaacttaggcataggaaaattacaaaggaga
aatgaaagtggtgttgttaatacatccaaggaaactgcacaactactttcctgtcaagac
tcattttataagaatttcaccatcgattgttctaaagtacagattactgtcgatttattt
ttggcttctgaagattatatggacgttgcatcactatcgaatttgagtcgtttcactgct
ggtcaaacgcatttctatcctggtttttcaggcaagaacccaaatgatattgtcaaattt
tccactgagtttgccaagcacatttccatggatttctgtatggaaaccgtaatgagagcc
cgtggttccacaggtttgagaatgagtagattctatggtcacttcttcaatagatcatct
gatttatgtgcattttccaccatgccaagagatcaatcatacttattcgaagttaacgtt
gatgaatccattatggctgactattgttatgttcaagtagcggtacttttatctctgaat
aatagtcaacgtagaataagaattataacattggctatgccaaccacggaatcgttggca
gaagtctacgcatctgctgaccaattagctatagcgtcgttttacaactcgaaggcggtg
gagaaagcattgaattccagtttggacgatgcaagagtattgatcaacaaatccgtgcaa
gatatcttagccacgtacaagaaggaaatagtggtgtccaacactgcagggggggcccca
ttgaggttatgtgccaatttgagaatgttcccattgttaatgcattctttaactaagcat
atggcatttagatctggtattgtcccaagtgaccatcgcgcctcggccttgaacaactta
gaatcattacctttgaaatatctaatcaaaaacatctaccctgatgtttattcgctgcat
gatatggctgatgaggctgggttaccagtgcaaactgaagatggtgaagctactggcaca
attgttttgcctcaaccaatcaatgctacctcttcgttgtttgaaagatacggtctatac
ttgatagataatggtaacgaattgtttttgtggatgggtggtgacgctgtaccagcgcta
gtattcgatgtgtttggaacacaggatatctttgacattccaattggcaaacaggaaata
cctgttgttgaaaattctgaattcaatcaaagagtaagaaacattatcaaccaattgaga
aaccatgatgatgtcatcacttaccaatcattgtatattgttaggggtgcctctttgagc
gagcccgttaaccatgcatctgctagggaagttgcaacgctaagactatgggcttctagc
accttagtggaggataagattttgaataacgaaagttacagagaattcttacaaatcatg
aaagccagaattagcaaataa

DBGET integrated database retrieval system