KEGG   Saccharomyces cerevisiae (budding yeast): YIL131CHelp
Entry
YIL131C           CDS       T00005                                 

Gene name
FKH1
Definition
(RefSeq) forkhead family transcription factor FKH1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Forkhead FHA Linker_histone
Motif
Other DBs
NCBI-GeneID: 854675
NCBI-ProteinID: NP_012135
SGD: S000001393
UniProt: P40466
Position
IX:complement(100781..102235)
Genome map
AA seq 484 aa AA seqDB search
MSVTSREQKFSGKYSSYTAQDRQGLVNAVTCVLSSSSDPVAVSSDYSNSLSIAREVNAYA
KIAGCDWTYYVQKLEVTIGRNTDSLNLNAVPGTVVKKNIDIDLGPAKIVSRKHAAIRFNL
ESGSWELQIFGRNGAKVNFRRIPTGPDSPPTVLQSGCIIDIGGVQMIFILPEQETIISDY
CLNHLMPKLLSTYGTNGNNNPLLRNIIEGSTYLREQRLQEEARLQQLDHLHTPLSSSSDV
NPIGDPHGDTIMMEEDEEDENYTRGGIRPNTYTSSSNNAVTNGNVPHIENPSDLSLDENR
YIKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKA
FEKVPKRAGQQGKGMNWKISDEVRRDFLNKWNAGKLSKIRRGASVTRQLQLHMSKFGEIP
APESSSIDPRGIKAQKVKKSLQATSSILGESAPQLQRTQLTGQISTTTSMDVTTNANVNN
SSLS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttaccagtagggaacaaaaatttagtggtaagtatagttcgtatacagcccag
gatcgccaagggcttgttaatgcggtgacatgtgttcttagctcgtcaagcgatcctgtg
gctgtgtcaagtgactattccaatagcttgagtattgccagagaggtcaacgcttatgct
aaaattgccggatgtgattggacgtattatgtacaaaaattagaagttaccattggtagg
aacacagacagcttgaacttgaatgctgtgcccggtacagtcgtgaagaagaatatagac
attgatcttggtcctgccaaaattgtgtctaggaagcatgctgcaatcagattcaacctg
gagagcggatcatgggaattacagatattcggtagaaatggtgctaaggtcaattttaga
aggattcccacaggtccagactctcctcctacggtgctacagtctggttgtatcatagac
ataggtggtgtgcaaatgatctttatattgccggaacaagaaactattatatcggattat
tgcctgaatcacctcatgcccaaattactatctacttatggtacgaatggtaacaacaac
ccgttgctacgtaacattatcgaaggttctacctatttaagagagcaaaggttacaggaa
gaggctcgattacaacagctggaccacctacacaccccattatcgtcatcatcagatgtt
aacccaataggggatccacatggagacacgattatgatggaagaagatgaagaagatgaa
aattacaccagaggaggaattagaccgaatacatacacgtccagtagcaacaatgctgtc
actaacggtaatgtaccccatatagaaaatccatcagacttgtcgctggatgaaaacaga
tatatcaaaccaccacagtcgtatgcatcgatgatcacccaagccattctttcaacaccc
gaaggtagtatttcattagcggatatttacaaatttatctctgacaactacgcattttac
aggttttctcaaatggcgtggcagaactccgtgaggcataatctgtccctaaataaagcc
ttcgagaaggtgcccaaaagagctggtcaacaaggtaaagggatgaattggaaaattagc
gatgaagtcaggcgtgattttttgaacaagtggaatgctggtaaattgagtaagattaga
cgaggcgcctctgtgacaagacagctgcaattgcacatgtccaaatttggagaaatacct
gctcctgaatcttcatcaattgacccgagggggataaaagcacagaaggtgaaaaagtct
ttacaagctacgagctcgattttaggtgaaagcgccccgcaattacaaagaactcaactc
actggccaaatttctactacgacatccatggacgtaacaacaaacgcaaacgtgaacaat
tcctctctgagttga

DBGET integrated database retrieval system