KEGG   Saccharomyces cerevisiae (budding yeast): YIL134W
Entry
YIL134W           CDS       T00005                                 

Gene name
FLX1
Definition
(RefSeq) flavin adenine dinucleotide transporter FLX1
  KO
K15115  solute carrier family 25 (mitochondrial folate transporter), member 32
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YIL134W (FLX1)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YIL134W (FLX1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 854672
NCBI-ProteinID: NP_012132
SGD: S000001396
UniProt: P40464
Position
IX:97395..98330
AA seq 311 aa
MVDHQWTPLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIR
SSANSGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGND
HKMNSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGF
QGLWKGLVPALFGVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVS
VTLVYPFQLLKSNLQSFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCIT
FCVYENLKHRL
NT seq 936 nt   +upstreamnt  +downstreamnt
atggtcgatcaccagtggacgccactgcagaaggaggttatctcaggtctgtccgcggga
tccgtcaccacattggtagtgcatccattagatttactgaaggttcgtttgcaattatcc
gctacaagcgcacaaaaggcccattacggcccatttatggtaatcaaagagattatacgt
tcgtcggcgaatagtggacgtagtgttacgaacgaactgtatcgcggattaagcataaat
ttgtttggaaatgccattgcatggggagtttatttcggtttatatggtgtcacgaaagaa
ttgatatacaagtcagtggcaaagccaggggaaacacagcttaaaggtgttgggaacgac
cacaaaatgaattcgcttatttatttgtctgccggtgcttccagtgggttgatgacagct
atcctaacaaaccctatctgggttataaagaccaggataatgtctacaagtaaaggcgcc
caaggagcgtacacttctatgtacaacggtgtccaacaactgttacgaactgatggcttc
cagggcctatggaagggccttgtacccgcactgtttggtgtttcgcaaggtgccttatat
tttgcagtttacgataccttaaagcaaagaaaattgcgacggaagagggaaaatgggctt
gacatccatttaacaaatcttgaaaccattgaaatcacatcgttgggaaaaatggtctcc
gtcactttggtttacccttttcaattattgaaatcaaacttacaaagtttcagggccaat
gagcaaaaatttaggctctttcctttgataaaattaatcattgctaatgatggttttgtt
ggactttataagggcctatctgcaaacttagtacgggccattccatccacttgcattacc
ttttgtgtatacgagaaccttaagcataggctttag

DBGET integrated database retrieval system