KEGG   Saccharomyces cerevisiae (budding yeast): YIL136WHelp
Entry
YIL136W           CDS       T00005                                 

Gene name
OM45
Definition
(RefSeq) Om45p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF148
Motif
Other DBs
NCBI-GeneID: 854670
NCBI-ProteinID: NP_012130
SGD: S000001398
UniProt: P16547
Position
IX:93619..94800
Genome map
AA seq 393 aa AA seqDB search
MSSRIIVGSAALAAAITASIMVREQKAKGQRREGNVSAYYNGQEYGSSAPPQLGKLHNIK
QGIKEDALSLKDALLGVSQKAREEAPKVTKRVISPEEDAQTRKQLGQKAKDSSSQSIFNW
GFSEAERRKAIAIGEFDTAKKRFEEAVDRNEKELLSTVMREKKAALDRASIEYERYGRAR
DFNELSDKLDQQERNSNPLKRLLKNNTGDANTEEAAARSVQGWGDTAQEFGREELEEAKR
NASSEPSEAQKRLDELKKIKEKGWFGYNKGEQSEQQIAERVARGLEGWGETAAQLSKDEM
DDLRWNYENSKKQLDKNVSDAMDSLSKAKEDLKQYGSHWWSGWTSKVDNDKQALKDEAQK
KYDEALKKYDEAKNKFKEWNDKGDGKFWSSKKD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaagaataattgtcggcagtgcagcattggcagctgccatcacagctagcatc
atggtcagagaacagaaggccaagggtcagagaagagagggcaacgtctccgcttactac
aacggccaggagtacggcagttcagcacccccacagttgggaaagctacataacataaag
caaggcataaaggaagatgccttgtcgttaaaagacgcgcttctgggcgtatctcaaaag
gctagggaagaggctccaaaggtaactaagcgtgtgatatcaccggaagaggatgctcag
acacgcaagcagctaggccaaaaagccaaggattcttcctcgcaaagcatcttcaattgg
gggtttagtgaggctgaaagaaggaaagccatagccatcggggaatttgatactgctaag
aagcgtttcgaagaggcagtggatcgtaatgagaaggagctcttgtccacggtgatgaga
gagaagaaggccgctctggacagagcatccattgagtacgaaaggtacgggagagccaga
gactttaatgagctttcggacaagctagaccaacaggaaaggaacagtaatcctttgaaa
cgcctgttgaagaataacacgggtgacgctaatactgaagaagccgctgcaagaagtgtc
caaggctggggtgatacggcacaggagtttggtagagaagagttggaggaagccaagaga
aatgcttcttcagagccaagcgaggcgcaaaaacgtcttgacgagctgaagaagatcaag
gaaaagggctggtttggttacaacaaaggggagcaaagcgagcaacagattgctgaacgg
gtagccagaggtttagaaggatggggtgaaacagccgctcaactttccaaggacgaaatg
gacgatttaagatggaattatgagaattcaaagaaacaactggataagaacgtgtccgat
gccatggactcgttatctaaggcgaaggaggacttgaaacagtacggcagccactggtgg
tctggatggacttccaaggtcgacaatgacaagcaggctttaaaagatgaggcccaaaag
aagtacgatgaagcgttgaaaaagtacgatgaagccaagaacaaattcaaagaatggaat
gataagggtgatggtaaattctggagctcgaaaaaggactag

DBGET integrated database retrieval system