KEGG   Saccharomyces cerevisiae (budding yeast): YIL138CHelp
Entry
YIL138C           CDS       T00005                                 

Gene name
TPM2
Definition
(RefSeq) tropomyosin TPM2
  KO
K17945  tropomyosin, fungi type
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YIL138C (TPM2)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YIL138C (TPM2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sce04812]
    YIL138C (TPM2)
Membrane trafficking [BR:sce04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    YIL138C (TPM2)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    YIL138C (TPM2)
Cytoskeleton proteins [BR:sce04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     YIL138C (TPM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tropomyosin_1 Tropomyosin KLRAQ APG6_N Spc7 TMF_DNA_bd Laminin_II ATG16 WXG100 GAS Atg14 CENP-F_leu_zip Taxilin IFT57 BLOC1_2 EzrA Laminin_I DHR10 OmpH Uso1_p115_C MscS_porin DUF1664 ERM DUF3584 FlaC_arch DUF724 DivIC T2SSM DUF3450 STAT_alpha Ax_dynein_light Filament DUF4795 Cast Fez1 AAA_13 DUF3037 ABC_tran_CTD MbeD_MobD Seryl_tRNA_N BBP1_C KELK DUF2353 APG17 Exonuc_VII_S XhlA ZYG-11_interact Rho_Binding DUF745
Motif
Other DBs
NCBI-GeneID: 854668
NCBI-ProteinID: NP_012128
SGD: S000001400
UniProt: P40414
Position
IX:complement(89230..89715)
Genome map
AA seq 161 aa AA seqDB search
MEKIKEKLNSLKLESESWQEKYEELREQLKELEQSNTEKENEIKSLSAKNEQLDSEVEKL
ESQLSDTKQLAEDSNNLRSNNENYTKKNQDLEQQLEDSEAKLKEAMDKLKEADLNSEQMG
RRIVALEEERDEWEKKCEEFQSKYEEAQKELDEIANSLENL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggagaagatcaaagagaaattgaatagcttaaaattagaatctgagtcatggcaagaa
aaatatgaggagctgagagaacagctcaaagaattagagcaatctaacactgaaaaagaa
aacgagattaaatctttgtccgctaaaaacgagcaactcgacagtgaagtggagaagtta
gagagtcaattgtctgatacaaagcaattggctgaagactccaataacttgagatctaat
aatgagaactacaccaagaaaaaccaggatctagaacaacagctagaagacagtgaagcc
aaactgaaggaagcaatggataaactgaaagaggccgatttgaactctgagcaaatgggt
agaaggatcgttgctttggaagaagaaagagatgaatgggaaaagaagtgcgaagaattc
caaagcaaatatgaagaagctcaaaaagaattggacgaaattgctaattcattggaaaat
ttatga

DBGET integrated database retrieval system