KEGG   Saccharomyces cerevisiae (budding yeast): YIL142WHelp
Entry
YIL142W           CDS       T00005                                 

Gene name
CCT2, BIN3, TCP2
Definition
(RefSeq) chaperonin-containing T-complex subunit CCT2
  KO
K09494  T-complex protein 1 subunit beta
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sce03110]
    YIL142W (CCT2)
   03036 Chromosome and associated proteins [BR:sce03036]
    YIL142W (CCT2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YIL142W (CCT2)
Chaperones and folding catalysts [BR:sce03110]
 Heat shock proteins
  HSP60 / Chaperonin
   YIL142W (CCT2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   BBS-CCT complex
    YIL142W (CCT2)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YIL142W (CCT2)
  Exosomal proteins of colorectal cancer cells
   YIL142W (CCT2)
  Exosomal proteins of bladder cancer cells
   YIL142W (CCT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn60_TCP1 DUF1104 CRM1_repeat
Motif
Other DBs
NCBI-GeneID: 854664
NCBI-ProteinID: NP_012124
SGD: S000001404
UniProt: P39076
Structure
PDB: 

Position
IX:83302..84885
Genome map
AA seq 527 aa AA seqDB search
MSVQIFGDQVTEERAENARLSAFVGAIAVGDLVKSTLGPKGMDKLLQSASSNTCMVTNDG
ATILKSIPLDNPAAKVLVNISKVQDDEVGDGTTSVTVLSAELLREAEKLIDQSKIHPQTI
IEGYRLASAAALDALTKAAVDNSHDKTMFREDLIHIAKTTLSSKILSQDKDHFAELATNA
ILRLKGSTNLEHIQIIKILGGKLSDSFLDEGFILAKKFGNNQPKRIENAKILIANTTLDT
DKVKIFGTKFKVDSTAKLAQLEKAEREKMKNKIAKISKFGINTFINRQLIYDYPEQLFTD
LGINSIEHADFEGVERLALVTGGEVVSTFDEPSKCKLGECDVIEEIMLGEQPFLKFSGCK
AGEACTIVLRGATDQTLDEAERSLHDALSVLSQTTKETRTVLGGGCAEMVMSKAVDTEAQ
NIDGKKSLAVEAFARALRQLPTILADNAGFDSSELVSKLRSSIYNGISTSGLDLNNGTIA
DMRQLGIVESYKLKRAVVSSASEAAEVLLRVDNIIRARPRTANRQHM
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtacagatatttggagaccaggttacagaagaaagagcggaaaacgcccgtttg
tcggcgtttgtcggtgccattgccgtgggtgatttggtgaaaagcacattaggcccaaaa
gggatggataaattattgcaaagtgcgtccagtaacacttgcatggtaacaaacgatggt
gctacgattctgaagtcaattccgctggataatcccgcagccaaagtgttggtgaacatc
agtaaggtgcaggatgacgaagttggagatggtaccactagtgttactgttttgagcgca
gagttgcttagagaagcagagaagttgattgatcaatccaaaatccaccctcaaactatt
attgaaggttaccgactagcttcagcagccgcattggatgcgttaacgaaagcggctgtt
gacaactctcatgataagaccatgttccgtgaagatctgatccatattgccaagactact
ttatcttccaaaattttgtctcaggataaggatcacttcgcagaattagcaactaatgct
attttgagattgaagggctccactaacttagaacatattcagatcattaagattcttggt
ggaaagctatcagattcgttccttgacgaaggtttcattcttgccaaaaaatttggtaac
aaccaacccaagagaattgaaaatgctaagattctaatcgccaatacaactttggataca
gacaaggtcaaaatattcggcaccaaattcaaagtcgattctactgctaaattggcacaa
ctagaaaaggcagaacgtgaaaagatgaagaataaaattgccaagatttccaagtttggt
atcaacactttcatcaatagacaactaatttatgactatccagagcaattatttacagat
ttgggcataaactcaattgagcatgctgattttgaaggtgtagaaaggctcgccctggtt
acaggcggtgaggtggtgtctacatttgacgagccaagtaaatgcaaactgggagaatgt
gacgtgatcgaggaaattatgcttggtgaacagccattcttgaagtttagtggttgcaaa
gctggtgaagcttgtaccatcgtcctaagaggtgctaccgaccaaacgcttgatgaagct
gagagatccctgcatgacgcattgtccgtgttgtcacagaccacaaaggaaacaagaact
gttcttggcggcggttgcgccgagatggtcatgtcaaaagctgtggacaccgaagctcaa
aacatcgacggaaagaagtcccttgccgtggaggcttttgcccgtgctctgagacaactg
ccaaccattttggcagataatgctggttttgacagcagcgaacttgtgtccaaactaaga
tcctccatatacaacggtatctccacctcaggtttagatctcaacaacggaaccattgcc
gacatgagacagttaggtatcgtcgagagttacaagctaaaacgagcagtagtcagctct
gcatctgaagccgctgaagttctactaagggtggataacatcatccgtgcaagaccaaga
accgccaatagacaacatatgtaa

DBGET integrated database retrieval system