KEGG   Saccharomyces cerevisiae (budding yeast): YIL145CHelp
Entry
YIL145C           CDS       T00005                                 

Gene name
PAN6
Definition
(RefSeq) pantoate--beta-alanine ligase PAN6
  KO
K01918  pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00410  beta-Alanine metabolism
sce00770  Pantothenate and CoA biosynthesis
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YIL145C (PAN6)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    YIL145C (PAN6)
Enzymes [BR:sce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     YIL145C (PAN6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pantoate_ligase
Motif
Other DBs
NCBI-GeneID: 854661
NCBI-ProteinID: NP_012121
SGD: S000001407
UniProt: P40459
Position
IX:complement(76354..77283)
Genome map
AA seq 309 aa AA seqDB search
MKIFHTVEEVVQWRTQELRETRFRETIGFVPTMGCLHSGHASLISQSVKENTYTVVSIFV
NPSQFAPTEDLDNYPRTLPDDIKLLESLKVDVLFAPNAHVMYPQGIPLDIEEQKGPFVSV
LGLSEKLEGKTRPNFFRGVATVVTKLFNIVMADVAYFGQKDIQQFIVLQCMVDELFVNTR
LQMMPIVRNNNGLALSSRNKYLCPESLKISENLYRGLKAAENAIRRLAPGGRLSRSEIID
TVTQIWAPYVDSHDFKIDYVSLADFKTLDELSDVENTSEQQPIVISCAVYVTDREKPDTV
VRLIDNIVI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcttccatactgtcgaagaagttgttcaatggagaacacaggagctgagggaa
actagatttagagaaactattgggttcgttcccacaatgggttgcctgcattcgggtcac
gctagtttgatctcgcagtctgtgaaggaaaacacctatactgtggtcagtatatttgta
aatccctcccagtttgcgccaacggaagatctagataactatcctcgaactttgccagac
gacatcaaattgcttgagtcgttgaaggtggatgttctatttgctcctaatgcacacgtg
atgtatccacagggaattccgctcgacatagaagagcagaaaggcccttttgttagtgtt
cttggattgagtgaaaaattagaggggaagacgagacctaacttctttaggggcgtggca
actgtcgtgactaaactattcaatatcgttatggcggatgtggcttattttgggcagaag
gacattcaacagttcattgttttacagtgtatggtggacgaactgtttgttaatacaagg
ctacaaatgatgcctattgtaagaaacaataatggactggctctgagtagtagaaacaaa
tatctttgtccagagtctttaaagatctctgaaaacctttaccgcgggctgaaagctgcg
gaaaatgctattaggagactagcaccagggggacgtctctccagatcagaaatcatcgat
actgtgactcaaatatgggcaccctacgttgattcccacgatttcaaaatcgactatgtt
tccttagcagattttaagactcttgatgaactctccgatgttgaaaacaccagcgaacag
cagccaatagtcattagttgtgctgtatacgtgactgaccgcgaaaaacccgatacggtc
gtcagactaatagataacatcgttatttaa

DBGET integrated database retrieval system