KEGG   Saccharomyces cerevisiae (budding yeast): YIL147CHelp
Entry
YIL147C           CDS       T00005                                 

Gene name
SLN1, YPD2
Definition
(RefSeq) Sln1p
  KO
K11231  osomolarity two-component system, sensor histidine kinase SLN1 [EC:2.7.13.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04139  Mitophagy - yeast
Module
sce_M00516  SLN1-YPD1-SSK1/SKN7 (osmosensing) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YIL147C (SLN1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04139 Mitophagy - yeast
    YIL147C (SLN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YIL147C (SLN1)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sce02022]
    YIL147C (SLN1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     YIL147C (SLN1)
Protein kinases [BR:sce01001]
 Histidine kinases
  Other
   YIL147C (SLN1)
Two-component system [BR:sce02022]
 Other families
  SLN1-YPD1-SSK1/SKN7 [MD:M00516]
   YIL147C (SLN1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HATPase_c HisKA HAMP
Motif
Other DBs
NCBI-GeneID: 854659
NCBI-ProteinID: NP_012119
SGD: S000001409
UniProt: P39928
Structure
PDB: 

Position
IX:complement(69791..73453)
Genome map
AA seq 1220 aa AA seqDB search
MRFGLPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYI
AAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSS
NLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVL
NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAV
YNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTA
LGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP
IVRLQKATELITEGRGLRPSTPRTISRASSFKRGFSSGFAVPSSLLQFNTAEAGSTTSVS
GHGGSGHGSGAAFSANSSMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLG
PHSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA
LLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK
IRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ
RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKEL
SEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEE
ITKRNTVANESIYKKVNDREKASNDDVSSIVSTTTSSYDNAIFNSQFNKAPGSDDEEGGN
LGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL
ANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVA
KSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQL
QEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIPTVKD
DDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNM
IFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRP
KLKTILTEFCAAYQGKKNNK
NT seq 3663 nt NT seq  +upstreamnt  +downstreamnt
atgcgatttggcctgccatcaaaattggaactcactcctccgtttaggataggcatccga
actcaactaacggcactagttagtatagtggctttgggctcactgattattctggctgta
acgacaggggtctattttacctcgaactataaaaatttaaggtccgatagactgtacatt
gccgctcagttaaagtcatcacagattgaccaaactctaaactacttatattaccaggcg
tactatttggcatcaagagacgccctgcaaagctcactaacaagttacgttgcaggtaac
aagagtgcagataattgggtagattccttgagtgtgattcaaaaatttttgagctcttca
aacttgttttatgttgctaaagtttacgattcttcatttaatgctgttttgaacgctacg
aataatggaactggtgatctaattccagaagatgttttagacagtttgttcccattatcc
accgatacaccgctaccttcttcactggaaactataggtatattgacggatccagtacta
aatagcaccgactatttgatgtctatgtctttacctatttttgccaatccttctattatc
ttgactgattcaagggtttacggatacattactataataatgtcggcagagggtctgaaa
agtgtgttcaacgatacaactgctttagaacattccacaattgccattatttctgcagta
tataatagtcaaggcaaagcttcagggtatcattttgtctttccaccgtatggatcacga
tcagacctcccgcaaaaagttttttctataaaaaatgatacattcattagtagcgcattt
agaaacgggaagggagggtctttgaaacaaaccaatatcctttctacacggaatactgct
ttaggctattcaccatgttcgtttaacctagttaattgggtcgcgatagtttcacagcct
gagtcggttttcctttctccagcaacgaaactagcaaaaatcatcaccggcactgtcatc
gctattggtgtctttgtcattttgttaacccttcctctagcacactgggcagtgcaacca
attgtacgtctacaaaaggcaactgaattaattacagaggggagaggccttcgaccgagc
accccaagaacgataagcagagccagttcattcaaaagaggatttagttctggatttgct
gttccttcttcgttattacaatttaatactgctgaagctggcagcaccacaagcgtaagt
ggccatggaggcagtggccatggcagtggtgcagctttttcagcaaatagtagcatgaaa
agcgctataaaccttggaaatgagaaaatgtcacctccagaggaggagaacaaaataccg
aataaccacaccgatgctaaaatatcaatggatggctcgctaaatcacgatttgcttgga
ccacattccttgagacataatgacactgacagaagttccaatagatctcacattctcaca
acttctgcaaatttaactgaagctaggctaccagattatagaagactattttctgatgaa
ctttccgatttaacagaaaccttcaatactatgacagacgcattagaccaacattatgct
cttctagaagaaagagttagggcgaggacaaaacaactcgaagctgccaagattgaggca
gaggccgcaaatgaagcaaaaaccgtctttattgccaatatttcgcacgaattgagaacg
cctttaaatggtattctgggtatgacggctatttcaatggaagaaaccgatgttaacaaa
ataagaaatagtttaaaactcatttttagatcaggtgagcttttgcttcatattctaacg
gaattgttaactttttccaaaaacgttcttcaaagaacgaaactggagaaaagagatttt
tgcattaccgatgttgccttacaaataaaatcgatatttggtaaagttgcaaaggatcag
cgtgttcgtctttcaatatcattgtttcctaatttgataaggacaatggttctttggggt
gattccaacagaattattcaaattgtgatgaatctagtgtccaatgcactaaagttcacc
cctgtagatggtaccgttgatgtaagaatgaaactgttgggtgaatacgacaaagaatta
agcgagaagaagcaatacaaagaagtgtatatcaaaaaagggacagaagtaaccgaaaat
ttagaaactacagataaatacgatcttccaactttatcgaaccataggaaaagtgtcgat
ttagaatccagcgctacttccctaggaagtaatagagacacttcgacaattcaggaagag
ataacaaaaagaaatactgttgcgaatgaaagtatctataagaaagtgaatgacagggaa
aaagcttcgaatgatgatgtatcttctatagtatcaacaactaccagctcgtatgataac
gctatcttcaatagtcagttcaataaagcacctggctcagatgatgaagaaggtggtaac
ctaggaagacctatcgaaaaccccaaaacgtgggttatttctattgaagtggaagacact
gggcctggtattgacccttccttacaagaatctgtatttcatccatttgttcaaggtgat
caaacattgtccaggcaatatggtggtactggcttaggtctatcaatctgtagacagtta
gcaaatatgatgcatggaacgatgaaattagagtcgaaagtaggtgttggtagtaaattc
acttttaccttgccattaaatcaaactaaagagatcagttttgcagatatggagtttcct
tttgaggacgaatttaatcctgagagtagaaagaacagaagagtcaagtttagtgttgct
aaaagcatcaagagccgacaatccacatcatctgttgcaacaccagctacaaatagaagt
agcctaaccaacgacgtgctaccggaggtaagaagtaaaggtaagcatgagacgaaagat
gttggaaatcctaacatgggaagagaagaaaaaaacgacaatggagggcttgaacaactg
caggaaaaaaatattaaaccttctatatgtcttacaggtgctgaagttaacgaacaaaat
tccttgtcttctaagcatcgttctcgacatgaaggtctaggttctgtcaatcttgataga
ccatttttgcaaagtactggtacagccacatcaagtagaaacatccccacagtcaaagac
gacgataaaaatgaaacaagtgtcaaaattttggttgtagaagataatcatgtaaatcag
gaagttatcaaaagaatgttgaacttggagggcattgaaaatattgaactggcttgcgat
ggccaagaagcattcgacaaagttaaagaattgacatctaagggcgaaaattataatatg
attttcatggatgtccagatgcctaaagtggatggtttactttctaccaagatgataagg
cgcgatttaggttatacctcacctattgtcgctctaaccgcttttgctgacgatagcaac
attaaagaatgtttggaatcaggaatgaacggatttttatcgaaaccaatcaaaagacca
aaattgaaaactattcttactgagttttgtgcagcatatcagggaaagaaaaataacaaa
tga

DBGET integrated database retrieval system