KEGG   Saccharomyces cerevisiae (budding yeast): YIR002CHelp
Entry
YIR002C           CDS       T00005                                 

Gene name
MPH1
Definition
(RefSeq) 3'-5' DNA helicase
  KO
K14635  ATP-dependent DNA helicase MPH1 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YIR002C (MPH1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YIR002C (MPH1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     YIR002C (MPH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ResIII Helicase_C DEAD SWI2_SNF2 AAA_22 PhoH
Motif
Other DBs
NCBI-GeneID: 854818
NCBI-ProteinID: NP_012267
SGD: S000001441
UniProt: P40562
Position
IX:complement(357415..360396)
Genome map
AA seq 993 aa AA seqDB search
MASADDYFSDFEDDELDKLYEKAINKSVKETITRRAVPVQKDLHDNVLPGQKTVYEEIQR
DVSFGPTHHELDYDALSFYVYPTNYEVRDYQYTIVHKSLFQNTLCAIPTGMGKTFIASTV
MLNYFRWTKKAKIIFTAPTRPLVAQQIKACLGITGIPSDQTAILLDKSRKNREEIWANKR
VFFATPQVVENDLKRGVLDPKDIVCLVIDEAHRATGSSAYTNVVKFIDRFNSSYRLLALT
ATPASDLEGVQEVVNNLDISKIEIRTEESMDIVKYMKKRKKEKIEVPLLLEIEDIIEQLG
MAVKPVLQQAIELGIYEECDPSQINAFKAMQQSQKIIANPTIPEGIKWRNFFILQLLNNV
GQMLKRLKIYGIRTFFNYFQNKCTEFTTKYNLKKSTNKIAAEFYYHPILKNIKNQCENYL
SDPKFVGHGKLQCVRDELMDFFQKRGSDSRVIIFTELRESALEIVKFIDSVADDQIRPHI
FIGQARAKEGFDEVKYTRKHAPKGRKKVERLHRQEQEKFLEAERTKRAANDKLERSARRT
GSSEEAQISGMNQKMQKEVIHNFKKGEYNVLVCTSIGEEGLDIGEVDLIICYDTTSSPIK
NIQRMGRTGRKRDGKIVLLFSSNESYKFERAMEDYSTLQALISKQCIDYKKSDRIIPEDI
IPECHETLITINDENEIINEMEDVDEVIRYATQCMMGKKVKPKKAITKKKRVQENKKPKK
FFMPDNVETSIVSASTLINKFLVNESGGKQLVTSNENPSKKRKIFKALDNLENDSTEEAS
SSLETEDEEVSDDNNVFIAEGQNGCQKDLETAIIRTGESLTTLKPLHNFERPNMALFVND
CGLPTKIEKNVKDIRGNQHNLEKEKSCTVDKNNMVLSLDDWNFFRNRYIPEGVSFDVEPN
FVQYTKGVKVPHCHKVSKIITLFNDESNDNKKRTIDMNYTKCLARGMLRDEKKFVKVNDK
SQVDNNSVNHDSSQSFTLSNAELDDILGSDSDF
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atggctagtgcagatgattactttagtgatttcgaagatgacgagctggataaactgtat
gaaaaggctatcaataaatctgtgaaggaaactataacgagacgtgctgtaccagttcaa
aaagaccttcatgataacgttttacctgggcagaaaactgtgtacgaagaaattcaaaga
gatgtcagttttggacccactcatcatgagcttgattacgatgctttgtcgttctacgtg
taccctacaaattacgaggtaagggattatcagtatacaattgttcacaaatcactgttt
caaaatacgttatgcgccatcccaacgggtatgggtaaaacgttcattgccagtacagta
atgttaaattattttcgttggaccaaaaaagccaaaataatctttactgctccaacaaga
cctttggtagcccagcaaattaaggcatgcttaggtataacaggaataccttcggatcaa
actgctatattactcgataaaagcaggaaaaatagagaagaaatttgggccaataagaga
gttttctttgccacaccgcaagtagtggagaatgacttgaagaggggtgtattggatcct
aaggatattgtatgtcttgtcatcgatgaagctcacagagctactggctcctctgcgtat
acaaatgtggtaaaattcatagataggttcaattcatcatacagattattagcattgacc
gctacaccagcctctgacctggaaggtgtccaagaagtggttaataacttagatatttcc
aagattgaaattaggactgaagaaagcatggatatcgtgaaatatatgaagaaaagaaaa
aaggaaaaaattgaagtgccccttttgttggaaattgaagacataatcgaacaattaggt
atggccgtcaaaccagtgcttcaacaggcaattgaactcggtatatatgaggaatgtgac
ccttcacaaataaacgccttcaaagccatgcaacaaagccaaaaaattattgctaaccct
actatacctgaaggaattaagtggaggaacttctttattttacagttattgaacaatgtg
ggtcaaatgctaaagagattaaaaatttatggaataaggacatttttcaattacttccag
aataaatgtacagaattcactacgaaatataatcttaaaaaatctactaataaaattgca
gctgagttttattaccatccgattttgaaaaacatcaaaaatcaatgcgaaaattattta
agtgatccaaagtttgtcggtcatgggaagttacaatgtgttagagatgaactaatggac
ttttttcagaaaaggggttccgactcgagggttattatttttacagaattaagagaaagc
gcacttgaaattgtgaagttcatagactcggtagctgacgatcaaatcaggcctcatatt
tttattggacaagctcgtgcaaaagaaggttttgatgaggtcaaatacacaagaaaacat
gcgccaaagggaaggaagaaggtagagagattgcataggcaagagcaagagaaatttttg
gaagctgaacgaactaagagagcggcgaatgataaacttgaaagaagtgccagacgaacg
gggagctctgaagaggctcagattagcggaatgaaccaaaaaatgcaaaaagaggttatc
cataatttcaaaaagggtgaatataatgttctcgtttgtacatcaattggagaagaaggt
ttggatatcggagaagttgatttaataatctgttatgatactacaagtagtccaatcaaa
aatattcagcgtatgggtagaacaggcagaaaacgagatggtaagatagtactactgttt
agcagtaatgaatcatacaaattcgagcgtgctatggaagactattcaaccctgcaagcg
cttatatccaagcaatgcattgactataaaaaatcagatcggataatccctgaagacatt
attccggaatgtcacgagacattgatcacgattaatgatgaaaacgaaataattaatgaa
atggaagatgttgacgaagttattcgttatgcgactcagtgtatgatgggcaaaaaggtg
aagccaaaaaaagccataacaaagaagaagagagttcaggaaaataaaaaaccgaagaag
ttctttatgcctgataatgttgagaccagtattgttagtgcaagcactttaattaataag
ttcttggtgaatgaaagtggcgggaaacaactagtaacgagtaatgaaaacccaagtaag
aagcggaagatttttaaagctttggataatctggagaatgattcaaccgaggaagcttcc
tcctcattagaaactgaagatgaagaagtcagtgatgataataatgttttcattgcggaa
gggcagaatggatgccaaaaagatttggaaactgccattattcgcactggcgaaagtctt
accacactcaagccacttcataattttgaacgccctaatatggctttatttgtgaatgat
tgtggtcttccaactaaaatcgagaaaaatgtgaaagacatccgaggaaatcaacacaac
cttgaaaaagaaaagagctgtactgttgacaagaataacatggtattgagtttggacgat
tggaattttttcagaaaccgctatatcccagaaggtgtttccttcgatgtggagcccaat
tttgtacaatacaccaaaggggtaaaagttccgcattgtcacaaagtttcaaaaatcatt
acgttatttaacgacgagagtaatgataataagaagaggacaattgatatgaactatact
aaatgtttggcgagaggcatgttacgagacgaaaaaaaatttgtaaaagttaacgataaa
agtcaagtcgataacaacagtgtcaaccatgattcatcccaatcttttaccttatcgaac
gcagaattagatgacatactgggctcagattctgatttttga

DBGET integrated database retrieval system