KEGG   Saccharomyces cerevisiae (budding yeast): YIR012W
Entry
YIR012W           CDS       T00005                                 

Gene name
SQT1
Definition
(RefSeq) Sqt1p
  KO
K14818  ribosome assembly protein SQT1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YIR012W (SQT1)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    YIR012W (SQT1)
SSDB
Motif
Pfam: ANAPC4_WD40 PQQ DUF1493
Other DBs
NCBI-GeneID: 854829
NCBI-ProteinID: NP_012277
SGD: S000001451
UniProt: P35184
Structure
PDB: 
4ZOX 4ZOV 5AMS

Position
IX:378486..379781
AA seq 431 aa
MEPQEEFITTEEVEQEIVPTVEVEQDVPVDIEGENDDDDEMMNDDEEALEVDMSNNSLTY
FDKHTDSVFAIGHHPNLPLVCTGGGDNLAHLWTSHSQPPKFAGTLTGYGESVISCSFTSE
GGFLVTADMSGKVLVHMGQKGGAQWKLASQMQEVEEIVWLKTHPTIARTFAFGATDGSVW
CYQINEQDGSLEQLMSGFVHQQDCSMGEFINTDKGENTLELVTCSLDSTIVAWNCFTGQQ
LFKITQAEIKGLEAPWISLSLAPETLTKGNSGVVACGSNNGLLAVINCNNGGAILHLSTV
IELKPEQDELDASIESISWSSKFSLMAIGLVCGEILLYDTSAWRVRHKFVLEDSVTKLMF
DNDDLFASCINGKVYQFNARTGQEKFVCVGHNMGVLDFILLHPVANTGTEQKRKVITAGD
EGVSLVFEVPN
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggaacctcaagaagagtttataactaccgaagaagttgagcaggagattgtgcccact
gtggaggtcgaacaagacgttcccgttgatattgaaggagagaatgacgacgatgatgaa
atgatgaatgatgatgaggaagctttggaggtcgacatgtccaacaactcgcttacctat
ttcgataagcacacagactccgtgtttgccattggccatcatcctaacctgccgctagta
tgtaccggtgggggtgataacttggcacatctttggacatcacattcacagccacccaag
tttgctggcactctaaccggttatggcgaatctgtgatttcatgttctttcacttctgaa
gggggcttcttggtcactgccgatatgtcggggaaggttcttgtacacatgggtcaaaaa
ggtggcgctcagtggaagttggcatcgcaaatgcaagaagtcgaagagattgtttggctg
aaaactcatcccactatagcaaggacgtttgcgtttggtgcaactgatggatctgtttgg
tgctaccagattaatgagcaggatggttctttggaacagttaatgtctggttttgtacac
cagcaagattgctctatgggtgaattcattaacaccgacaagggtgaaaatacgctggaa
ttagtcacttgttctttggatagcactattgtggcatggaattgcttcactggccaacaa
ttatttaagatcacacaggcagaaatcaagggattagaagctccatggatttccctatca
ttagctccggaaactttgaccaagggtaactcgggtgtcgtggcatgtgggtccaacaat
ggtcttctggcagtaattaattgtaacaatggcggtgcgattttacatttatctacagtg
attgaactaaagccagaacaagacgaattagatgcctccattgaatccatttcttggtca
tccaaattctcccttatggccattggccttgtctgcggtgaaatactcttatatgataca
agtgcatggagagtaagacacaagtttgttctcgaagattctgttacaaaacttatgttt
gataatgatgacttattcgcatcgtgtatcaatggtaaggtttaccagtttaatgcaaga
actggccaagagaagtttgtttgtgtgggccataatatgggggttcttgattttatatta
ctgcatcctgtggcaaataccggcaccgagcagaagagaaaagtaataactgcaggtgat
gaaggtgtatctctggtgttcgaggtaccaaactga

DBGET integrated database retrieval system