KEGG   Saccharomyces cerevisiae (budding yeast): YIR028W
Entry
YIR028W           CDS       T00005                                 

Gene name
DAL4
Definition
(RefSeq) allantoin permease
  KO
K03457  nucleobase:cation symporter-1, NCS1 family
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    YIR028W (DAL4)
SSDB
Motif
Pfam: Transp_cyt_pur
Other DBs
NCBI-GeneID: 854846
NCBI-ProteinID: NP_012294
SGD: S000001467
UniProt: Q04895
Position
IX:408468..410375
AA seq 635 aa
MANDALSAIFSNPSRKGVQPSTSIVSYTNNEDDIIDVENGKFNKNKNINTNVYVDNSSIE
ESEVVPLPETKSIWSKIYYDFIVLDKTTLNVSLKESFLYNRDLKPVEEERRCWSWFNYLY
FWLADCFNINTWQIAGTGLQLGLNWWQCWLTVWIGYTFAGIFVVLNSRFGSAYHLSFPIT
VRASFGIFFSMWPIINRVVMAIVWYAVQAWLGATPVALMLKSIFGKNLEDRIPNHFGSPN
STTFEFMCFFIFWVVSIPFVLVAPHKIRHLFTVKAALIPFAAFGFLIWALKKSHGKIELG
TLNDYSPHGSEFSWIFVRSLMACVANFAALIINAPDFGRFAKNPQASLWPQLVAIPLFFA
ITCLIGIIVTAAGYHLYGVNYWSPLDVLGQFLETTYTRGTRAGVFLISFVFALAQLGTNI
SANSLACGADMTALFPRYINIRRGSLFCVAMALCICPWNLMASSSKFTSALGAYAIFLSS
IAGVICADYFVVRRGYVKLTHLFLAQKGSFYMFGNKFGANWRAFVAYICGIAPNLPGFIG
DVGAPKITVSEGAMRLYYLGYPVGFFISAVIYLILCYFFPVPGTPVTNFLTEKGWFQRWA
YVEDFEQDWKNELRRDDLCDDTVSIYDGTEEKIVY
NT seq 1908 nt   +upstreamnt  +downstreamnt
atggctaacgacgctctaagtgctattttcagtaatccttcgaggaaaggtgtccaaccc
tccacatctattgtgtcatatacaaacaatgaagatgatattatagatgtggaaaatggg
aagttcaacaagaacaagaatatcaacactaatgtgtatgtggacaactcctcaatagag
gagagcgaagtcgtgcccttgcccgaaacaaagtccatctggagtaaaatatactacgat
ttcattgtgttagacaagacaactttgaatgtttcgttgaaagagtcgttcttgtataac
agagacttgaaaccggttgaagaagaaagaaggtgttggtcctggttcaattacttatat
ttctggctggcagactgtttcaatattaacacatggcaaatagctggtacaggtctacaa
ctaggtctgaattggtggcaatgttggcttacagtttggatcggctacacttttgcaggt
atcttcgtagtattgaactcgagatttggttccgcatatcacttatctttccctattact
gttagggcctcatttggtatattcttttctatgtggccgattataaatcgtgtcgtgatg
gctatagtatggtatgccgtgcaagcctggttaggtgcaacgcccgtggcactgatgcta
aaatctatttttggcaagaatctggaagatagaatcccaaaccattttggttctccaaat
agcactacttttgaattcatgtgtttctttatattttgggtggtcagtataccatttgtc
ctagtggctcctcataaaatcaggcatttattcacagtaaaagcagctttgatccccttc
gcagcctttggatttttaatctgggctttgaagaaatcgcacggtaaaattgagttgggg
acgctgaatgattattcacctcatggttccgaattttcatggatattcgttagatcccta
atggcctgtgttgctaactttgccgctttgattatcaacgcccctgacttcggtagattt
gccaaaaatcctcaagcgtctttgtggccacaattggttgccatcccattgttcttcgcc
ataacatgtttgatcggtatcattgttactgcggccggttatcacttatatggggttaac
tattggtcaccactggatgtacttggtcaatttttggagaccacttacaccagaggtact
agggctggtgtgttcttgatttcttttgtatttgccttagctcaactgggtacaaacatt
tctgccaactctctggcatgtggtgctgatatgacggctttgtttccaagatatattaat
attagaagaggttctttattctgtgtggcaatggctctatgtatctgtccatggaactta
atggccagttcaagtaagttcaccagcgctttgggtgcttatgcaattttcctttccagt
attgctggtgtcatttgcgcggattatttcgtagtaagaagaggatatgtgaaattaaca
catttattcctggcacagaagggttccttttacatgtttggaaacaaatttggtgccaat
tggagggcctttgttgcgtatatttgcggtatcgctccaaatttaccaggttttataggt
gatgttggagctccaaaaattacggtttcagagggtgcaatgaggttatactatttaggt
tatccggtaggtttctttattagtgcggtgatatacctcatattatgttacttttttcct
gtccctggtactcccgtaaccaattttctgacagagaaaggatggttccaaagatgggct
tatgttgaggacttcgagcaagattggaagaatgagttacgtagggatgacctctgcgat
gacacagtcagtatctatgatggcaccgaggaaaagatagtttactaa

DBGET integrated database retrieval system