KEGG   Saccharomyces cerevisiae (budding yeast): YIR032CHelp
Entry
YIR032C           CDS       T00005                                 

Gene name
DAL3
Definition
(RefSeq) ureidoglycolate hydrolase
  KO
K01483  ureidoglycolate lyase [EC:4.3.2.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00230  Purine metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YIR032C (DAL3)
Enzymes [BR:sce01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.3  ureidoglycolate lyase
     YIR032C (DAL3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ureidogly_lyase
Motif
Other DBs
NCBI-GeneID: 854850
NCBI-ProteinID: NP_012298
SGD: S000001471
UniProt: P32459
Position
IX:complement(415030..415617)
Genome map
AA seq 195 aa AA seqDB search
MVTVVAETLTKESFEEYGTIISPDEEISRMQNLEKGANQGTAIKLLQVSQVENKSTSKVP
NWNLFRCFPQPHLNRVFTQGSNQAISHSIKVLEKHPCSTQTFVPMGRTSAEVAYLVVVAK
EIGNKPDLSTLRAFTCLGNQAVTYGLGTWHAPMIVLGKEEHLDFSVLIYESLDPDRPEKD
CVEEHYSDGDVCIII
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccgtggtggcggagacattgacgaaagagtccttcgaggagtatgggacgata
atttcgccagatgaagagatttcaaggatgcaaaaccttgaaaaaggtgcaaaccaggga
acagcgatcaaattgcttcaagtaagccaggtagagaataaatctaccagtaaagttccc
aattggaacctattccgttgctttccacagccgcacctgaatagagtattcactcaaggc
tccaatcaggcgatttctcattctatcaaagtcctcgaaaagcatccgtgtagtacgcag
acgtttgtgcctatggggagaacgtcagcggaagtagcatacttggtagtagtcgctaaa
gaaattggaaataagccagacttgtctacgttgagggcttttacatgtttgggtaatcag
gccgttacctatggcttaggtacctggcatgcgcccatgatagtacttggcaaggaagaa
catttggatttttcagtcttaatctacgaaagtctggaccctgacaggcccgagaaggac
tgtgtggaagaacactacagcgatggcgacgtttgtattatcatctaa

DBGET integrated database retrieval system