KEGG   Saccharomyces cerevisiae (budding yeast): YIR037WHelp
Entry
YIR037W           CDS       T00005                                 

Gene name
HYR1, GPX3, ORP1
Definition
(RefSeq) peroxiredoxin HYR1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00480  Glutathione metabolism
sce00590  Arachidonic acid metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    YIR037W (HYR1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YIR037W (HYR1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     YIR037W (HYR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 854855
NCBI-ProteinID: NP_012303
SGD: S000001476
UniProt: P40581
Structure
PDB: 

Position
IX:423128..423619
Genome map
AA seq 163 aa AA seqDB search
MSEFYKLAPVDKKGQPFPFDQLKGKVVLIVNVASKCGFTPQYKELEALYKRYKDEGFTII
GFPCNQFGHQEPGSDEEIAQFCQLNYGVTFPIMKKIDVNGGNEDPVYKFLKSQKSGMLGL
RGIKWNFEKFLVDKKGKVYERYSSLTKPSSLSETIEELLKEVE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaattctataagctagcacctgttgacaagaaaggccaaccattccccttcgac
caattaaagggaaaagtggtgcttatcgttaatgttgcctccaaatgtggattcactcct
caatacaaagaactagaggccttgtacaaacgttataaggacgaaggatttaccatcatc
gggttcccatgcaaccagtttggccaccaagaacctggctctgatgaagaaattgcccag
ttctgccaactgaactatggcgtgactttccccattatgaaaaaaattgacgttaatggt
ggcaatgaggaccctgtttacaagtttttgaagagccaaaaatccggtatgttgggcttg
agaggtatcaaatggaattttgaaaaattcttagtcgataaaaagggtaaagtgtacgaa
agatactcttcactaaccaaaccttcttcgttgtccgaaaccatcgaagaacttttgaaa
gaggtggaatag

DBGET integrated database retrieval system