KEGG   Saccharomyces cerevisiae (budding yeast): YJL024CHelp
Entry
YJL024C           CDS       T00005                                 

Gene name
APS3, YKS7
Definition
(RefSeq) Aps3p
  KO
K12399  AP-3 complex subunit sigma
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YJL024C (APS3)
Membrane trafficking [BR:sce04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    YJL024C (APS3)
 Endosome - Golgi transport
    YJL024C (APS3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Clat_adaptor_s MSP7_C
Motif
Other DBs
NCBI-GeneID: 853429
NCBI-ProteinID: NP_012510
SGD: S000003561
UniProt: P47064
Position
X:complement(join(395931..396493,396571..396592))
Genome map
AA seq 194 aa AA seqDB search
MIHAVLIFNKKCQPRLVKFYTPVDLPKQKLLLEQVYELISQRNSDFQSSFLVTPPSLLLS
NENNNDEVNNEDIQIIYKNYATLYFTFIVDDQESELAILDLIQTFVESLDRCFTEVNELD
LIFNWQTLESVLEEIVQGGMVIETNVNRIVASVDELNKAAESTDSKIGRLTSTGFGSALQ
AFAQGGFAQWATGQ
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgattcatgcagttctaatattcaataagaaatgccaaccaagattagtgaaattctac
acgccggtcgaccttccaaagcaaaaactgctattagagcaagtatatgaattgatttct
caaaggaatagcgattttcaaagttcttttttagtcacgccaccatcgcttctgttaagc
aatgaaaataataatgatgaggtaaacaatgaagatattcaaatcatctataaaaactac
gctacactatatttcactttcatcgtggatgatcaagaatcagaactggccatattagat
ctgatccaaacttttgtggaatcattggaccgttgttttactgaagtcaatgaacttgat
ttgatttttaactggcaaactttggaaagtgtattagaagaaatcgtgcaggggggcatg
gtcattgaaacaaatgtgaacagaatagttgcttctgttgacgaactcaacaaagctgcc
gagtccacagatagtaaaattggaagactaacgtccactggatttggaagcgcactacaa
gcgtttgctcaaggcggatttgcacaatgggcaacggggcaataa

DBGET integrated database retrieval system