KEGG   Saccharomyces cerevisiae (budding yeast): YJL026WHelp
Entry
YJL026W           CDS       T00005                                 

Gene name
RNR2, CRT6
Definition
(RefSeq) ribonucleotide-diphosphate reductase subunit RNR2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00230  Purine metabolism
sce00240  Pyrimidine metabolism
sce00480  Glutathione metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YJL026W (RNR2)
   00240 Pyrimidine metabolism
    YJL026W (RNR2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YJL026W (RNR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YJL026W (RNR2)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     YJL026W (RNR2)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    YJL026W (RNR2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_sm DUF4744
Motif
Other DBs
NCBI-GeneID: 853427
NCBI-ProteinID: NP_012508
SGD: S000003563
UniProt: P09938
Structure
PDB: 

Position
X:392404..393603
Genome map
AA seq 399 aa AA seqDB search
MPKETPSKAAADALSDLEIKDSKSNLNKELETLREENRVKSDMLKEKLSKDAENHKAYLK
SHQVHRHKLKEMEKEEPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIH
DWNNRMNENERFFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHS
ETYSLLIDTYIKDPKESEFLFNAIHTIPEIGEKAEWALRWIQDADALFGERLVAFASIEG
VFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDPAIVEKIV
TEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYKVENPFDFMENI
SLAGKTNFFEKRVSDYQKAGVMSKSTKQEAGAFTFNEDF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaagagaccccttccaaagctgctgccgatgcattgtccgacttggaaatcaaa
gattccaagtccaaccttaacaaggaattggagacattgagagaggaaaacagagtaaag
tcagacatgcttaaggagaaattgagcaaggacgctgaaaatcacaaggcttacttgaaa
tctcatcaagttcaccgtcacaaacttaaggaaatggaaaaggaggaacctttgttgaat
gaagacaaggagagaactgttcttttccctatcaagtaccatgaaatctggcaagcctac
aagcgtgccgaagcttctttctggaccgctgaagaaattgatttgtctaaggatatccat
gactggaacaacagaatgaacgaaaacgagagatttttcatttccagagttcttgccttt
ttcgccgcttctgacggtattgttaatgaaaacttggttgaaaacttctccaccgaagtc
caaattccagaggcaaagagtttctacggtttccaaatcatgattgaaaatattcactct
gaaacttactccttgttgatcgatacttacatcaaggaccctaaagaaagtgaattcttg
ttcaatgccattcacaccatcccagaaatcggtgagaaggccgaatgggctttaagatgg
attcaagacgctgacgccttgtttggtgaaagactagttgcctttgcctccattgaaggt
gtctttttctccggttcctttgcctccattttctggttgaaaaagagaggtatgatgccc
ggtttaaccttttccaacgaattgatctgtagagacgaaggtttgcacaccgactttgca
tgcttgttgttcgcccatttgaagaacaaaccagacccagccattgttgaaaaaattgtc
accgaggctgtggaaattgaacaaagatacttcttggacgccttaccagttgctttgcta
ggtatgaacgctgacttaatgaaccaatacgttgagttcgtcgccgacagactgttggtt
gctttcggtaacaagaaatactacaaggtcgaaaaccccttcgatttcatggaaaacatc
tccttggccggtaagaccaacttcttcgaaaagagagtttctgactaccaaaaggctggt
gttatgtccaagtcgactaagcaagaagccggtgctttcaccttcaacgaagacttttaa

DBGET integrated database retrieval system