KEGG   Saccharomyces cerevisiae (budding yeast): YJL029CHelp
Entry
YJL029C           CDS       T00005                                 

Gene name
VPS53
Definition
(RefSeq) Vps53p
  KO
K20299  vacuolar protein sorting-associated protein 53
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YJL029C (VPS53)
Membrane trafficking [BR:sce04131]
 Protein recycling
  Others
   EARP complex
    YJL029C (VPS53)
 Endosome - Golgi transport
  Tethering complex
   GARP complex
    YJL029C (VPS53)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Vps53_N VPS53_C DUF1664
Motif
Other DBs
NCBI-GeneID: 853423
NCBI-ProteinID: NP_012505
SGD: S000003566
UniProt: P47061
Structure
PDB: 

Position
X:complement(388385..390853)
Genome map
AA seq 822 aa AA seqDB search
MLEGTVDYDPLEDITNILFSKESLNNIDELISITRSYKKQLQEDILKEENELKEHPKNSA
EIEASLRKVFQDFKETQDVSASTELTISNLTEGISYLDIAKKNLTHSLTLFQNLKILTDS
YIQCNELLSQGSFKKMVSPYKIMCSLAENTFISYKSLDEINYLLSSISRLKGDTLSKIKQ
NYNALFSGGNISEHDTALTMELREGACELLDCDTSTRAQMIDWCLDKLLFEMKEIFRVDD
EAGSLENLSRRYIYFKKILNNFNSKFADYFLKDWEMAVRLTTTFYHITHKDLQTLLKREF
KDKNPSIDLFMTALQSTLDFEKYIDVRFSKKIKEPKLSSCFEPYLTLWVSHQNQMMEKKF
LSYMSEPKYPSNETESLVLPSSADLFRTYRSVLTQTLELIDNNANDSILTSLANFFSRWL
QTYSQKILLPLLLPDNIEVQDKLEAAKYTVLLINTADYCATTIDQLEDKLSEFSGNREKL
ANSFTKTKNIYDDLLAKGTSFLLNRVIPLDLNFVWREFINNDWSNAAIEDYSRYMVTLKS
VLKMPALTDASIKQQQEQPSTLAFILSQFNRDVYKWNFLDKVIDIITTNFVSNTIRLLQP
VPPFSLAGSKRKFETRTVVNIGEQLLLDLELLKEIFHTLPESVSNDSDLRENTSYKRVKR
HADNNIDQLLKFIKLLMAPLDSADDYYETYSKLTNNNPDSAVWSFVLALKGIPWDLALWK
KLWSAYNLETDDTDEGSRPDSNRDLFIFKWDKVLLGQFENNLARMQDPNWSKFVRQDLKI
SPPVMKRIVSTPQIQQQKEEQKKQSLSVKDFVSHSRFFNRGT
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaggtacggtagattatgacccgctggaagatattaccaatatacttttttca
aaagaatccctgaacaacatagatgaactgatcagtattaccagaagctacaaaaagcaa
ttgcaagaggatattctcaaagaagagaatgaattgaaggaacaccctaaaaattccgct
gaaatagaggcttctctgaggaaagttttccaagatttcaaagaaactcaagatgtctca
gcctccaccgagttgacgatatcgaatctgacagaaggtatctcgtacctggacattgcc
aagaaaaacctcacccactctttgactcttttccaaaatttaaagatattgacagacagt
tacatacaatgcaatgaattactctcacagggctcattcaaaaaaatggtgtccccttat
aagataatgtgttcgcttgctgaaaacacattcatctcttacaaatcattggacgagata
aactatttgttgagctccatttcaagactgaaaggagacactttgtccaaaattaaacaa
aactacaatgcgctcttttccggcggcaatatctcagagcatgatacagcactcactatg
gaattgcgcgaaggtgcctgcgagctactcgactgcgatacaagtacgagagcccagatg
atagattggtgtttggacaaacttctcttcgaaatgaaagagatatttagggtcgacgat
gaagccggatccctagaaaatttatcgagaagatacatttacttcaaaaaaattcttaat
aacttcaattcaaagttcgcagactatttcttaaaagactgggaaatggcagtcagattg
accaccactttttatcacattacacacaaggaccttcagacacttctgaaaagggaattc
aaagacaagaacccttccattgatctattcatgacagcattacaatcgacgctagatttc
gaaaaatacatcgacgtacgattttcaaaaaaaattaaggaaccaaaactaagttcctgc
ttcgaaccttatttgactttatgggtgtctcaccaaaaccaaatgatggaaaagaaattt
ctttcttatatgagtgagccgaagtacccatctaatgaaacagaatctctcgtgttaccc
tcgagtgcagaccttttcaggacatatcgttccgtactgactcagaccttagagctcatt
gataataatgccaatgatagcatattgacttcattggcaaattttttcagtagatggctt
caaacttactcacaaaaaattcttcttcctttactgctgcccgacaatattgaagtccag
gataagctagaagctgccaagtataccgttttattgatcaatactgcagattattgtgcc
acgactatagatcaattggaggataaattatctgaattcagcggtaatcgtgaaaagctg
gcaaacagttttacgaaaacgaaaaatatatacgacgatttactagcaaaaggaacttct
tttctattaaaccgtgtcatacccttagatctaaattttgtatggagagagtttatcaac
aatgattggtcaaatgctgcgatagaagattatagcaggtacatggtaaccctcaaatcc
gtacttaaaatgcccgcattaacagatgcctctattaaacaacagcaagagcaaccttcg
actttggcatttattttgtcgcaattcaatagagatgtttataagtggaatttcttggat
aaggtgattgatatcatcactacaaattttgtaagcaataccatccgccttctgcagccc
gttccacccttttccctggcgggcagcaaaaggaaatttgaaaccagaactgttgtcaac
attggcgagcagcttctccttgatttagaattgctgaaggagatttttcacactttacca
gaaagtgtaagtaacgattctgacttgcgagaaaatacctcttataagagggtgaaaaga
catgcagacaataatatagaccagctgctgaagtttattaaacttctaatggctcctctg
gattccgctgatgactattacgagacctactccaaattgaccaataataaccctgattca
gcggtatggtcttttgtcctcgctttaaagggcattccatgggacctggcattatggaaa
aagctatggagtgcctacaacttagaaacagacgacactgacgagggcagcaggccagac
agtaatcgcgatcttttcatattcaagtgggacaaggtacttttgggtcaatttgaaaac
aacttggcaaggatgcaagatccgaattggtcaaaatttgtgaggcaagatctgaaaata
tcaccacctgttatgaagaggatagtatccacccctcaaatacaacaacaaaaagaagaa
caaaaaaagcaaagtttgagtgtcaaagacttcgtttctcactcaaggttctttaacaga
ggcacttga

DBGET integrated database retrieval system