KEGG   Saccharomyces cerevisiae (budding yeast): YJL030WHelp
Entry
YJL030W           CDS       T00005                                 

Gene name
MAD2
Definition
(RefSeq) spindle checkpoint protein MAD2
  KO
K02537  mitotic spindle assembly checkpoint protein MAD2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YJL030W (MAD2)
   04113 Meiosis - yeast
    YJL030W (MAD2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     YJL030W (MAD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HORMA ATG101 V-set_CD47 ATG13
Motif
Other DBs
NCBI-GeneID: 853422
NCBI-ProteinID: NP_012504
SGD: S000003567
UniProt: P40958
Position
X:387657..388247
Genome map
AA seq 196 aa AA seqDB search
MSQSISLKGSTRTVTEFFEYSINSILYQRGVYPAEDFVTVKKYDLTLLKTHDDELKDYIR
KILLQVHRWLLGGKCNQLVLCIVDKDEGEVVERWSFNVQHISGNSNGQDDVVDLNTTQSQ
IRALIRQITSSVTFLPELTKEGGYTFTVLAYTDADAKVPLEWADSNSKEIPDGEVVQFKT
FSTNDHKVGAQVSYKY
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaatcaatatcactaaagggttcaacaaggacagttacagaatttttcgagtac
agcattaattccattttgtaccaaagaggcgtatacccagcagaagatttcgtaacggtg
aaaaagtacgatcttacgttactaaagacacatgatgatgaactgaaagattacattcgg
aaaattcttctacaagttcacaggtggcttcttggtggaaaatgcaatcaattagtatta
tgtattgtagacaaggatgagggagaggtggtggaaagatggtccttcaatgtgcaacac
atttctggcaatagcaacgggcaggatgatgttgtagatttaaatacaacacaatcacaa
atcagagctttaatcaggcaaatcacctcaagcgttacctttctgcccgaactaacaaaa
gaaggtgggtacacattcacagtacttgcatatacagacgcggatgctaaagttccgtta
gaatgggccgactccaatagtaaagagatacctgatggtgaagtagttcaattcaaaaca
ttctctaccaacgatcataaagttggtgcgcaggtcagctataaatattaa

DBGET integrated database retrieval system