KEGG   Saccharomyces cerevisiae (budding yeast): YJL031CHelp
Entry
YJL031C           CDS       T00005                                 

Gene name
BET4
Definition
(RefSeq) Rab geranylgeranyltransferase BET4
  KO
K14050  geranylgeranyl transferase type-2 subunit alpha [EC:2.5.1.60]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:sce01006]
    YJL031C (BET4)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YJL031C (BET4)
Enzymes [BR:sce01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.60  protein geranylgeranyltransferase type II
     YJL031C (BET4)
Prenyltransferases [BR:sce01006]
 Protein prenylation
  Rab geranylgeranyltransferase
   YJL031C (BET4)
Membrane trafficking [BR:sce04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    YJL031C (BET4)
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
    YJL031C (BET4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PPTA
Motif
Other DBs
NCBI-GeneID: 853421
NCBI-ProteinID: NP_012503
SGD: S000003568
UniProt: Q00618
Position
X:complement(join(386368..387348,387436..387438))
Genome map
AA seq 327 aa AA seqDB search
MHGIKRKQWTKELLRQKRVQDEKKIYDYRSLTENVLNMRDEKIYSIEALKKTSELLEKNP
EFNAIWNYRRDIIASLASELEIPFWDKELVFVMMLLKDYPKVYWIWNHRLWVLKHYPTSS
PKVWQTELAVVNKLLEQDARNYHGWHYRRIVVGNIESITNKSLDKEEFEYTTIKINNNIS
NYSAWHQRVQIISRMFQKGEVGNQKEYIRTEISYIINAMFTDAEDQSVWFYIKWFIKNDI
VCKTLDEQEYLKMLKDLRENILLINNDEIEFSGKQNIWCLKILLVLEDILEEKEALTERS
SEQYLVQLIDADPLRKNRYLHLLEQHK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcatggcattaaaaggaaacagtggaccaaggaattactgagacaaaagagagttcaa
gacgaaaagaaaatatatgattatagaagcttgactgaaaatgttttgaatatgagagat
gaaaaaatttactcaattgaagctctgaagaaaacatcagaacttcttgagaaaaatccg
gaatttaatgctatttggaattacagaagggatattatagcgagtttggcttctgagttg
gaaatacctttctgggataaagagttagtttttgtaatgatgctattgaaggattacccc
aaagtctattggatatggaatcacagactttgggtcttgaaacattatcctacgagttcc
cctaaagtgtggcaaactgaacttgctgtcgtgaataagttattggaacaagatgcaaga
aattaccacggatggcattaccgcagaatagttgttggtaacatagagagtatcactaat
aaaagtcttgacaaggaggagtttgaatacacaacaataaagattaacaataacatttca
aattattctgcatggcaccaaagagtacagatcataagcagaatgtttcagaaaggagag
gttgggaatcaaaaggagtatattcggactgaaatatcttatatcatcaacgctatgttt
accgacgccgaagaccaatccgtatggttttatatcaagtggttcattaaaaacgacatt
gtttgtaaaactctggacgaacaagagtaccttaaaatgttgaaagacttgagagaaaac
attctgttaataaataatgacgaaattgaattttccgggaagcaaaatatttggtgcttg
aaaattttattagttctcgaagatattctggaagaaaaggaagctctaacggaaagaagc
tcggaacaatatttggtccaattaatagatgcggatccgttaagaaagaatagataccta
catctcctggagcagcataagtga

DBGET integrated database retrieval system