KEGG   Saccharomyces cerevisiae (budding yeast): YJL033WHelp
Entry
YJL033W           CDS       T00005                                 

Gene name
HCA4, DBP4, ECM24
Definition
(RefSeq) RNA-dependent ATPase HCA4
  KO
K14776  ATP-dependent RNA helicase DDX10/DBP4 [EC:3.6.4.13]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YJL033W (HCA4)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     YJL033W (HCA4)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  90S particles
   Helicases
    YJL033W (HCA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII
Motif
Other DBs
NCBI-GeneID: 853419
NCBI-ProteinID: NP_012501
SGD: S000003570
UniProt: P20448
Position
X:383837..386149
Genome map
AA seq 770 aa AA seqDB search
MAKKNRLNTTQRKTLRQKEDEYIENLKTKIDEYDPKITKAKFFKDLPISDPTLKGLRESS
FIKLTEIQADSIPVSLQGHDVLAAAKTGSGKTLAFLVPVIEKLYREKWTEFDGLGALIIS
PTRELAMQIYEVLTKIGSHTSFSAGLVIGGKDVKFELERISRINILIGTPGRILQHLDQA
VGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVSTLSPSRQTLLFSATQSQSVADLARLSL
TDYKTVGTHDVMDGSVNKEASTPETLQQFYIEVPLADKLDILFSFIKSHLKCKMIVFLSS
SKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVCLFATDVVARGIDFP
AVDWVVQVDCPEDVDTYIHRVGRCARYGKKGKSLIMLTPQEQEAFLKRLNARKIEPGKLN
IKQSKKKSIKPQLQSLLFKDPELKYLGQKAFISYVRSIYVQKDKQVFKFDELPTEEFAYS
LGLPGAPKIKMKGMKTIEQAKERKNAPRQLAFLSKANEDGEVIEDKSKQPRTKYDKMFER
KNQTILSEHYLNITKAQAQEDEDDDFISVKRKDHEINEAELPALTLPTSRRAQKKALSKK
ASLASKGNASKLIFDDEGEAHPVYELEDEEEFHKRGDAEVQKTEFLTKESAVMADIDNID
KQVAKEKKQEKKRKRLEAMRREMEAAMEEEISGDEEEGKTVAYLGTGNLSDDMSDGDMPD
SEGHLKKKARTVDYSHGHNPSNSVDDDIIEVEEPQTLEDLESLTAKLIQG
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaaaaaatagattgaacacaactcaaagaaagactttacgtcaaaaggaagat
gagtacatcgaaaacttgaaaaccaaaattgatgagtatgaccctaagataaccaaggcc
aagtttttcaaagatctccccattagcgatcccacattaaaaggtttaagagaatcatcc
tttataaaacttactgagatccaagccgattctattcccgtgtccctgcaaggtcatgat
gtattggcggccgcaaagacaggttccggtaagacattagcatttttagttccagtaatt
gaaaagctataccgcgaaaaatggaccgaattcgatgggttaggtgcccttatcatatct
ccaacaagagagttggctatgcaaatatatgaggttttgacgaaaataggtagtcacact
tcattttcagctgggttagttatcggtggtaaagatgttaaattcgaactagaaaggata
tcaaggattaacattcttatcggtacacctggtcgtattttacaacatttagatcaagcc
gtaggtctaaatacttccaatttgcagatgcttgttcttgacgaagctgatagatgttta
gacatggggtttaaaaaaactctggatgccatcgtaagcacattgtcaccatctagacaa
acacttttattttcagcgactcaatcacaatctgttgcagacttggctaggctttccttg
acagattataaaaccgttggtacacatgatgtgatggatgggtcggttaacaaagaagca
tctactccagaaactttgcaacaattctacattgaagttcctttggcagataaattggat
atccttttcagttttataaaatcacatttaaaatgcaaaatgatcgttttcttatcaagt
tccaaacaagtgcattttgtctatgagacatttaggaagatgcagcctggtatttcttta
atgcatttacacggtagacagaaacaacgtgctaggacagaaactttggacaaattcaat
cgtgctcaacaggtgtgtctttttgctaccgatgtcgttgctagaggtattgactttcct
gcagtcgattgggttgttcaagtggattgtccagaggacgttgatacatatatccacaga
gtcggtagatgtgctcgttacggtaaaaagggtaaatctttaatcatgttgactccacaa
gagcaggaagcgttcctaaaaagacttaacgctagaaagatcgaaccaggcaaacttaat
ataaaacagtcaaaaaagaaatccattaaaccacaattgcagtcattattattcaaggat
ccagaactaaaatatctaggacaaaaggcttttatatcgtacgtgagatctatatatgtg
caaaaggacaaacaagttttcaaattcgatgagttaccaacagaagaattcgcttattct
cttggtttaccaggggccccaaaaatcaaaatgaagggtatgaagaccattgagcaggcc
aaagaaagaaagaatgctccaagacagctagctttcttatcaaaagcaaatgaagatggt
gaagtaattgaagataagtcgaaacaaccaagaacaaaatatgataaaatgtttgaacgt
aaaaatcaaaccatcttaagtgaacactatttgaatataacgaaggctcaagcacaagaa
gacgaggatgacgatttcatttctgtcaagcgtaaagatcatgaaataaatgaagctgag
ttaccagctctaactcttccaacttcaaggcgagcacagaagaaagcgctttcaaagaag
gcatctctggcctccaagggtaacgctagcaaattaatatttgatgatgaaggcgaagcc
catccagtttatgaacttgaagatgaagaagaatttcataagagaggtgatgcggaggta
caaaagacagaatttttaactaaagaatctgcagtaatggcagacattgacaatattgat
aagcaggtggctaaagaaaaaaaacaagagaagaagagaaaaagactagaagccatgaga
agggaaatggaggctgctatggaagaagaaatttctggagatgaagaagaagggaagaca
gtagcatatttaggaacaggaaacttgagcgatgatatgagcgacggtgatatgcctgac
tcggaaggccacttgaaaaagaaagctagaactgttgactattcccacggccacaatcca
tccaattcagttgatgatgacattattgaagtggaagaaccacaaactttggaggatttg
gaatctttgacagctaaattaatccagggttaa

DBGET integrated database retrieval system