KEGG   Saccharomyces cerevisiae (budding yeast): YJL034W
Entry
YJL034W           CDS       T00005                                 

Gene name
KAR2, GRP78
Definition
(RefSeq) Hsp70 family ATPase KAR2
  KO
K09490  endoplasmic reticulum chaperone BiP [EC:3.6.4.10]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03060  Protein export
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    YJL034W (KAR2)
   04141 Protein processing in endoplasmic reticulum
    YJL034W (KAR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sce03110]
    YJL034W (KAR2)
   04131 Membrane trafficking [BR:sce04131]
    YJL034W (KAR2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YJL034W (KAR2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.10  non-chaperonin molecular chaperone ATPase
     YJL034W (KAR2)
Chaperones and folding catalysts [BR:sce03110]
 Heat shock proteins
  HSP70 / DNAK
   YJL034W (KAR2)
Membrane trafficking [BR:sce04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    YJL034W (KAR2)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YJL034W (KAR2)
  Exosomal proteins of other body fluids (saliva and urine)
   YJL034W (KAR2)
  Exosomal proteins of colorectal cancer cells
   YJL034W (KAR2)
SSDB
Motif
Pfam: HSP70 MreB_Mbl Radial_spoke_3 BcrAD_BadFG Hydantoinase_A Spore_GerAC
Other DBs
NCBI-GeneID: 853418
NCBI-ProteinID: NP_012500
SGD: S000003571
UniProt: P16474
Structure
PDB: 
3QFU 3H0X 3QFP 3QML

Position
X:381327..383375
AA seq 682 aa
MFFNRLSAGKLLVPLSVVLYALFVVILPLQNSFHSSNVLVRGADDVENYGTVIGIDLGTT
YSCVAVMKNGKTEILANEQGNRITPSYVAFTDDERLIGDAAKNQVAANPQNTIFDIKRLI
GLKYNDRSVQKDIKHLPFNVVNKDGKPAVEVSVKGEKKVFTPEEISGMILGKMKQIAEDY
LGTKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIVNEPTAAAIAYGLDKSDKEHQI
IVYDLGGGTFDVSLLSIENGVFEVQATSGDTHLGGEDFDYKIVRQLIKAFKKKHGIDVSD
NNKALAKLKREAEKAKRALSSQMSTRIEIDSFVDGIDLSETLTRAKFEELNLDLFKKTLK
PVEKVLQDSGLEKKDVDDIVLVGGSTRIPKVQQLLESYFDGKKASKGINPDEAVAYGAAV
QAGVLSGEEGVEDIVLLDVNALTLGIETTGGVMTPLIKRNTAIPTKKSQIFSTAVDNQPT
VMIKVYEGERAMSKDNNLLGKFELTGIPPAPRGVPQIEVTFALDANGILKVSATDKGTGK
SESITITNDKGRLTQEEIDRMVEEAEKFASEDASIKAKVESRNKLENYAHSLKNQVNGDL
GEKLEEEDKETLLDAANDVLEWLDDNFETAIAEDFDEKFESLSKVAYPITSKLYGGADGS
GAADYDDEDEDDDGDYFEHDEL
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgtttttcaacagactaagcgctggcaagctgctggtaccactctccgtggtcctgtac
gcccttttcgtggtaatattacctttacagaattctttccactcctccaatgttttagtt
agaggtgccgatgatgtagaaaactacggaactgttatcggtattgacttaggtactact
tattcctgtgttgctgtgatgaaaaatggtaagactgaaattcttgctaatgagcaaggt
aacagaatcaccccatcttacgtggcattcaccgatgatgaaagattgattggtgatgct
gcaaagaaccaagttgctgccaatcctcaaaacaccatcttcgacattaagagattgatc
ggtttgaaatataacgacagatctgttcagaaggatatcaagcacttgccatttaatgtg
gttaataaagatgggaagcccgctgtagaagtaagtgtcaaaggagaaaagaaggttttt
actccagaagaaatttctggtatgatcttgggtaagatgaaacaaattgccgaagattat
ttaggcactaaggttacccatgctgtcgttactgttcctgcttatttcaatgacgcgcaa
agacaagccaccaaggatgctggtaccatcgctggtttgaacgttttgagaattgttaat
gaaccaaccgcagccgccattgcctacggtttggataaatctgataaggaacatcaaatt
attgtttatgatttgggtggtggtactttcgatgtctctctattgtctattgaaaacggt
gttttcgaagtccaagccacttctggtgatactcatttaggtggtgaagattttgactat
aagatcgttcgtcaattgataaaagctttcaagaagaagcatggtattgatgtgtctgac
aacaacaaggccctagctaaattgaagagagaagctgaaaaggctaaacgtgccttgtcc
agccaaatgtccacccgtattgaaattgactccttcgttgatggtatcgacttaagtgaa
accttgaccagagctaagtttgaggaattaaacctagatctattcaagaagaccttgaag
cctgtcgagaaggttttgcaagattctggtttggaaaagaaggatgttgatgatatcgtt
ttggttggtggttctactagaattccaaaggtccaacaattgttagaatcatactttgat
ggtaagaaggcctccaagggtattaacccagatgaagctgttgcatacggtgcagccgtt
caagctggtgtcttatccggtgaagaaggtgtcgaagatattgttttattggatgtcaac
gctttgactcttggtattgaaaccactggtggtgtcatgactccattaattaagagaaat
actgctattcctacaaagaaatcccaaattttctctactgccgttgacaaccaaccaacc
gttatgatcaaggtatacgagggtgaaagagccatgtctaaggacaacaatctattaggt
aagtttgaattaaccggcattccaccagcaccaagaggtgtacctcaaattgaagtcaca
tttgcacttgacgctaatggtattctgaaggtgtctgccacagataagggaactggtaaa
tccgaatctatcaccatcactaacgataaaggtagattaacccaagaagagattgataga
atggttgaagaggctgaaaaattcgcttctgaagacgcttctatcaaggccaaggttgaa
tctagaaacaaattagaaaactacgctcactctttgaaaaaccaagttaatggtgaccta
ggtgaaaaattggaagaagaagacaaggaaaccttattagatgctgctaacgatgtttta
gaatggttagatgataactttgaaaccgccattgctgaagactttgatgaaaagttcgaa
tctttgtccaaggtcgcttatccaattacttctaagttgtacggaggtgctgatggttct
ggtgccgctgattatgacgacgaagatgaagatgacgatggtgattatttcgaacacgac
gaattgtag

DBGET integrated database retrieval system