KEGG   Saccharomyces cerevisiae (budding yeast): YJL036WHelp
Entry
YJL036W           CDS       T00005                                 

Gene name
SNX4, ATG24, CVT13
Definition
(RefSeq) Snx4p
  KO
K17919  sorting nexin-4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YJL036W (SNX4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YJL036W (SNX4)
Membrane trafficking [BR:sce04131]
 SNARE
  SNARE associated proteins
   Others
    YJL036W (SNX4)
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    YJL036W (SNX4)
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Other Cvt associated proteins
    YJL036W (SNX4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PX Vps5 BAR_3_WASP_bdg Baculo_PEP_C DUF4391 Apolipoprotein Allexi_40kDa CALCOCO1 DUF4618 PhoU ING Laminin_II DUF948
Motif
Other DBs
NCBI-GeneID: 853416
NCBI-ProteinID: NP_012498
SGD: S000003573
UniProt: P47057
Position
X:378825..380096
Genome map
AA seq 423 aa AA seqDB search
MTDKGKNDLTSKAKDKARGNPEKPPYWFEIIVSDPQKRTGDPGSSSGYVSYQISTKTNNT
SFYDNRGDPESIIVVHRRYSDLLLLHDILLNRFPTCIIPPLPDKKVFQYIAGDRFSQRFT
QKRCHSLQNFLRRVSLHPDLSQSKVFKTFLVSKDWESHRKVLQDSLQPNKDEVTDAFMNA
FKTVHKQNEEFTEIREKSDKLDRTVTKIDKLFHKVVKKNDSMSEDYTKLGSNLQELQELV
TGENEELAAKLKIFNEGVTQLSYGLQDLTKYLDYEYIVDLKDLEHYIDSMRQLIKLKDQK
QIDYEELSDYLTRSIKEKNNLISGYGGSNFFANKLEELAGINQEASRREKINKLEGKITS
LTGELENAKKVADGFEQECLKEIDHFESVKTAEIKKSLGSLADHHIEFYERILEAWEKVD
DSL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaaaggcaagaacgatttaacaagcaaagctaaggacaaagccagaggcaac
cccgagaagccaccatattggtttgaaatcattgtttctgatccacaaaaaagaactggt
gacccaggctcttcatctggctacgtgagttatcagatatcaacaaagactaacaacacg
tcattttatgataatcgtggcgatccagaatctattatagttgtacatagaagatacagt
gacctattgctcctgcatgatattttactcaacaggttccccacctgcatcatcccgcca
ttacctgataagaaagtttttcaatacatagcaggcgataggtttagccaaagatttaca
caaaagagatgtcatagtttgcaaaatttcctaagaagggtctctttgcatcccgatctt
tctcaatcaaaagtcttcaaaacttttttggtgagtaaagattgggaatctcaccgcaaa
gtcctccaggatagcttgcaaccaaataaagatgaagttactgatgcttttatgaatgcc
ttcaaaacagttcacaagcaaaacgaagaattcactgagataagggagaaaagtgataaa
ctagatcggactgtgacaaagatagataaactttttcataaggttgtgaaaaaaaatgat
tcgatgtctgaagactatacaaagttgggcagtaatttacaggaattacaagaattggtc
acaggcgaaaacgaggaacttgctgcgaagttgaagatttttaatgaaggtgtaacacag
ctgtcatatggcttgcaagatcttacaaagtatctggattacgaatatattgttgatttg
aaggatcttgaacactacattgatagtatgcgacagctgatcaaattgaaagaccagaaa
cagatagactacgaagaactaagtgattatttaaccaggtcaatcaaagaaaaaaataac
ttgatttctggatacggaggtagtaatttctttgccaataaattggaagaactagcggga
ataaatcaggaggcttcacgtagagaaaaaatcaataaactagaaggcaaaataacgtca
ttaacaggtgaattagaaaacgctaaaaaggtggcggatggattcgaacaggaatgcttg
aaggaaatagaccatttcgaaagtgtaaaaacggctgaaatcaagaaatctctgggctca
ctagcggaccatcatatcgaattctacgaaaggatacttgaagcatgggaaaaagtagac
gatagtctatag

DBGET integrated database retrieval system