KEGG   Saccharomyces cerevisiae (budding yeast): YJL128CHelp
Entry
YJL128C           CDS       T00005                                 

Gene name
PBS2, HOG4, SFS4, SSK4
Definition
(RefSeq) mitogen-activated protein kinase kinase PBS2
  KO
K11227  mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    YJL128C (PBS2)
 Cellular Processes
  Transport and catabolism
   04139 Mitophagy - yeast
    YJL128C (PBS2)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     YJL128C (PBS2)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: STE group
  STE7 family
   YJL128C (PBS2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 HicB_lk_antitox Hep_59
Motif
Other DBs
NCBI-GeneID: 853313
NCBI-ProteinID: NP_012407
SGD: S000003664
UniProt: P08018
Position
X:complement(178097..180103)
Genome map
AA seq 668 aa AA seqDB search
MEDKFANLSLHEKTGKSSIQLNEQTGSDNGSAVKRTSSTSSHYNNINADLHARVKAFQEQ
RALKRSASVGSNQSEQDKGSSQSPKHIQQIVNKPLPPLPVAGSSKVSQRMSSQVVQASSK
STLKNVLDNQETQNITDVNINIDTTKITATTIGVNTGLPATDITPSVSNTASATHKAQLL
NPNRRAPRRPLSTQHPTRPNVAPHKAPAIINTPKQSLSARRGLKLPPGGMSLKMPTKTAQ
QPQQFAPSPSNKKHIETLSNSKVVEGKRSNPGSLINGVQSTSTSSSTEGPHDTVGTTPRT
GNSNNSSNSGSSGGGGLFANFSKYVDIKSGSLNFAGKLSLSSKGIDFSNGSSSRITLDEL
EFLDELGHGNYGNVSKVLHKPTNVIMATKEVRLELDEAKFRQILMELEVLHKCNSPYIVD
FYGAFFIEGAVYMCMEYMDGGSLDKIYDESSEIGGIDEPQLAFIANAVIHGLKELKEQHN
IIHRDVKPTNILCSANQGTVKLCDFGVSGNLVASLAKTNIGCQSYMAPERIKSLNPDRAT
YTVQSDIWSLGLSILEMALGRYPYPPETYDNIFSQLSAIVDGPPPRLPSDKFSSDAQDFV
SLCLQKIPERRPTYAALTEHPWLVKYRNQDVHMSEYITERLERRNKILRERGENGLSKNV
PALHMGGL
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggaagacaagtttgctaacctcagtctccatgagaaaactggtaagtcatctatccaa
ttaaacgagcaaacaggctcagataatggctctgctgtcaagagaacatcttcgacgtcc
tcgcactacaataacatcaacgctgaccttcatgctcgtgtaaaagcttttcaagaacaa
cgtgcattgaaaaggtctgccagcgtgggcagtaatcaaagcgagcaagacaaaggcagt
tcacaatcacctaaacatattcagcagattgttaataagccattgccgcctcttcccgta
gcaggaagttctaaggtttcacaaagaatgagtagccaagtcgtgcaagcgtcctccaag
agcactcttaagaacgttctggacaatcaagaaacacaaaacattaccgacgtaaatatt
aacatcgatacaaccaaaattaccgccacaacaattggtgtaaatactggcctacctgct
actgacattacgccgtcagtttctaatactgcatcagcaacacataaggcgcaattgctg
aatcctaacagaagggcaccaagaaggccgctttctacccagcaccctacaagaccaaat
gttgccccgcataaggcccctgctataatcaacacaccaaaacaaagtttaagtgcccgt
cgagggctcaaattaccaccaggaggaatgtcattaaaaatgcccactaaaacagctcaa
cagccgcagcagtttgccccaagcccttcaaacaaaaaacatatagaaaccttatcaaac
agcaaagttgttgaagggaaaagatcgaatccgggttctttgataaatggtgtgcaaagc
acatccacctcatcaagtaccgaaggcccacatgacactgtaggcactacacccagaact
ggaaacagcaacaactcttcaaattctggtagtagtggtggtggtggtcttttcgcaaat
ttctcgaaatacgtggatatcaaatccggctctttgaattttgcaggcaaactatcgcta
tcctctaaaggaatagatttcagcaatggttctagttcgagaattacattggacgaacta
gaatttttggatgaactgggtcatggtaactatggtaacgtctcaaaggtactgcataag
cccacaaatgttattatggcgacgaaggaagtccgtttggagctagatgaggctaaattt
agacaaattttaatggaactagaagttttgcataaatgcaattctccctatattgtggat
ttttatggtgcattctttattgagggcgccgtctacatgtgtatggaatacatggatggt
ggttccttggataaaatatacgacgaatcatctgaaatcggcggcattgatgaacctcag
ctagcgtttattgccaatgctgtcattcatggactaaaagaactcaaagagcagcataat
atcatacacagagatgtcaaaccaacaaatattttatgttcagccaaccaaggcaccgta
aagctgtgcgatttcggtgtttctggtaatttggtggcatctttagcgaagactaatatt
ggttgtcagtcatacatggcacctgaacgaatcaaatcgttgaatccagatagagccacc
tataccgtacagtcagacatctggtctttaggtttaagcattctggaaatggcactaggt
agatatccgtatccaccagaaacatacgacaacattttctctcaattgagcgctattgtt
gatgggccgccaccgagattaccttcagataaattcagttctgacgcacaagattttgtt
tctttatgtctacaaaagattccggaaagaagacctacatacgcagctttaacagagcat
ccttggttagtaaaatacagaaaccaggatgtccacatgagtgagtatatcactgaacga
ttagaaaggcgcaacaaaatcttacgggaacgtggtgagaatggtttatctaaaaatgta
ccggcattacatatgggtggtttatag

DBGET integrated database retrieval system