KEGG   Saccharomyces cerevisiae (budding yeast): YJL129C
Entry
YJL129C           CDS       T00005                                 
Symbol
TRK1
Name
(RefSeq) Trk1p
  KO
K24976  Trk/Ktr/HKT type cation transporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YJL129C (TRK1)
Transporters [BR:sce02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   YJL129C (TRK1)
SSDB
Motif
Pfam: TrkH YL1
Other DBs
NCBI-GeneID: 853312
NCBI-ProteinID: NP_012406
SGD: S000003665
UniProt: P12685
Position
X:complement(173599..177306)
AA seq 1235 aa
MHFRRTMSRVPTLASLEIRYKKSFGHKFRDFIALCGHYFAPVKKYIFPSFIAVHYFYTIS
LTLITSILLYPIKNTRYIDTLFLAAGAVTQGGLNTVDINNLSLYQQIVLYIVCCISTPIA
VHSCLAFVRLYWFERYFDGIRDSSRRNFKMRRTKTILERELTARTMTKNRTGTQRTSYPR
KQAKTDDFQEKLFSGEMVNRDEQDSVHSDQNSHDISRDSSNNNTNHNGSSGSLDDFVKED
ETDDNGEYQENNSYSTVGSSSNTVADESLNQKPKPSSLRFDEPHSKQRPARVPSEKFAKR
RGSRDISPADMYRSIMMLQGKHEATAEDEGPPLVIGSPADGTRYKSNVNKLKKATGINGN
KIKIRDKGNESNTDQNSVSSEANSTASVSDESSLHTNFGNKVPSLRTNTHRSNSGPIAIT
DNAETDKKHGPSIQFDITKPPRKISKRVSTFDDLNPKSSVLYRKKASKKYLMKHFPKARR
IRQQIKRRLSTGSIEKNSSNNVSDRKPITDMDDDDDDDDNDGDNNEEYFADNESGDEDER
VQQSEPHSDSELKSHQQQQEKHQLQQNLHRMYKTKSFDDNRSRAVPMERSRTIDMAEAKD
LNELARTPDFQKMVYQNWKAHHRKKPNFRKRGWNNKIFEHGPYASDSDRNYPDNSNTGNS
ILHYAESILHHDGSHKNGSEEASSDSNENIYSTNGGSDHNGLNNYPTYNDDEEGYYGLHF
DTDYDLDPRHDLSKGSGKTYLSWQPTIGRNSNFLGLTRAQKDELGGVEYRAIKLLCTILV
VYYVGWHIVAFVMLVPWIILKKHYSEVVRDDGVSPTWWGFWTAMSAFNDLGLTLTPNSMM
SFNKAVYPLIVMIWFIIIGNTGFPILLRCIIWIMFKISPDLSQMRESLGFLLDHPRRCFT
LLFPKAATWWLLLTLAGLNITDWILFIILDFGSTVVKSLSKGYRVLVGLFQSVSTRTAGF
SVVDLSQLHPSIQVSYMLMMYVSVLPLAISIRRTNVYEEQSLGLYGDMGGEPEDTDTEDD
GNDEDDDEENESHEGQSSQRSSSNNNNNNNRKKKKKKKTENPNEISTKSFIGAHLRKQLS
FDLWFLFLGLFIICICEGDKIKDVQEPNFNIFAILFEIVSAYGTVGLSLGYPDTNQSFSR
QFTTLSKLVIIAMLIRGKNRGLPYSLDRAIILPSDRLEHIDHLEGMKLKRQARTNTEDPM
TEHFKRSFTDVKHRWGALKRKTTHSRNPKRSSTTL
NT seq 3708 nt   +upstreamnt  +downstreamnt
atgcattttagaagaacgatgagtagagtgcccacattggcatctcttgaaatacgatat
aaaaaatctttcggccataaatttcgtgattttattgctctatgtggtcactattttgct
ccagttaaaaaatatatcttccccagttttatcgcggttcactacttctacacgatatcc
ctgacattaataacttcaatcctgctatatcccattaagaataccagatacattgataca
ttgtttttagcagcgggcgcagttacacaaggtggcttaaatactgtggatatcaacaat
ctaagcttataccaacaaattgttctgtatatcgtatgctgcatatcaacaccaattgca
gttcatagttgcttggcatttgtacggctttactggtttgagcgctacttcgatggtatt
agagactcttctagacgaaattttaagatgagaagaacgaaaacaatcttagaaagggaa
ctaacagcaagaaccatgaccaagaatagaacaggtacccaaagaacgtcttatcctagg
aaacaagctaaaacagatgatttccaagaaaaattgttcagcggagaaatggttaataga
gatgagcaggactcagttcacagcgaccagaattctcatgacattagtagggacagcagc
aataataatacgaatcacaatggtagcagtggcagtttagatgatttcgttaaggaagac
gaaacggatgacaatggagaatatcaggagaacaactcctactcgacggtaggtagttcg
tctaacacagttgcagacgaaagtttaaatcagaagcccaagccaagcagtcttcggttt
gatgagccacacagcaaacaaagacccgcaagagttccctcagagaaatttgcaaaaaga
aggggttcaagagatattagcccagccgatatgtatcgatccattatgatgctacaaggt
aagcatgaagcaactgctgaagatgaaggtccccctttagtcatcgggtcccctgcggat
ggcacaagatataaaagtaatgtcaataagctaaagaaggccaccggcataaatggtaac
aaaatcaagattcgagataagggaaatgaaagtaacactgatcaaaattccgtgtcaagt
gaagcaaacagtacggcgagcgtttcggacgaaagctcgttacacacaaattttggtaac
aaagtaccttcattaagaacaaatactcatagatcaaattcgggcccgatagccattact
gataacgcagaaacagacaaaaagcatgggccatcaattcaattcgatataactaaacct
cctagaaaaatttcaaaaagagtttcaaccttcgatgatttgaacccaaaatcttccgtt
ctttatcgaaaaaaagcatcgaagaagtacctcatgaaacattttcctaaagcgcggcga
atacggcaacaaattaagagaaggctttctactggttcaattgagaaaaacagcagtaac
aatgtttcagatagaaaacctattactgatatggatgatgatgatgatgacgatgacaac
gacggcgataacaacgaagaatactttgctgacaacgaaagcggcgatgaagatgaacga
gtacagcagtctgaaccacattctgattcagaactcaaatcgcaccaacaacagcaagaa
aaacaccaactgcagcagaacctgcaccgcatgtataaaaccaaatcatttgatgataat
cgttcaagagcagttcctatggaacgttccaggaccatcgatatggcagaggctaaggat
ctaaatgagctcgcaaggacgcctgattttcaaaaaatggtctatcaaaattggaaagcc
catcatagaaaaaaaccgaactttaggaagaggggatggaataacaagatatttgaacat
ggtccctatgcatctgacagcgatcgcaattatcctgataatagtaatactggaaacagt
attcttcattacgcagagtctattttacatcatgatggctctcataaaaatggaagcgaa
gaagcctcttccgactctaatgagaatatctattccacgaatggaggaagcgaccacaat
ggtcttaacaactatcctacttacaacgacgatgaagaaggctattatggtttacatttc
gataccgattatgacctagatcctcgtcatgatttatctaaaggcagtggtaaaacgtat
ctatcatggcaaccaactattggacgtaactcaaacttccttggattaacaagagcccag
aaagatgaattaggtggtgtcgagtacagagcaatcaaacttttatgcaccatattggtt
gtctactacgttggatggcatattgttgcttttgttatgttagtaccttggattattttg
aaaaagcattatagtgaagttgttagagatgatggtgtttcacctacatggtggggattt
tggacagcaatgagtgcatttaatgatttaggtttgacattaactccaaattcaatgatg
tcgtttaacaaagctgtatacccattgatcgttatgatttggtttatcattatcggaaat
acagggtttcccatccttcttagatgcatcatttggataatgtttaaaatttctcctgat
ttatcacagatgagagaaagtttaggttttctcttagaccatccacgtcgttgtttcacc
ttgctatttcctaaggcagctacatggtggctacttttaacgcttgcaggattgaatata
actgattggattttatttattattctagattttggctcaacagttgtgaaatcattatcg
aaaggctatagagtccttgtcggcctgtttcaatctgttagcacaagaactgctggattc
agcgttgtcgatttaagtcaactgcatccttctatccaagtctcctatatgctaatgatg
tatgtctccgtattaccattggccatctctattcgacggacaaatgtttacgaggagcaa
tctttaggactatatggagatatggggggagaaccagaagatacggatactgaagacgat
ggtaacgatgaagatgacgacgaggaaaacgagagtcacgaaggtcaaagtagtcaaaga
agtagttcgaacaacaacaacaataacaacaggaaaaagaaaaagaaaaagaaaactgaa
aatccaaatgaaatatctacaaaatcctttatcggtgcccatttaaggaaacagctttca
tttgacttgtggtttctatttttagggttatttatcatttgcatttgtgaaggggacaag
ataaaggacgtacaagaaccaaactttaatatatttgcaattctttttgaaattgttagc
gcttacggtacagttgggctatcgctaggttatccggacaccaaccaatcgttttcaaga
cagtttactacattatctaagttggtgatcatagctatgctgatcagaggcaagaataga
ggtctaccatactcactggatcgtgcaattatcttgcctagtgatagacttgaacatatt
gaccaccttgagggcatgaaattgaagagacaggctagaaccaatacagaagacccaatg
acggaacatttcaagagaagtttcactgatgtgaaacatcgttggggagctcttaagcgt
aagaccacacattcccgaaatcctaaaaggagcagcacaacgctctaa

DBGET integrated database retrieval system