KEGG   Saccharomyces cerevisiae (budding yeast): YJL133W
Entry
YJL133W           CDS       T00005                                 

Gene name
MRS3
Definition
(RefSeq) Fe(2+) transporter
  KO
K15113  solute carrier family 25 (mitochondrial iron transporter), member 28/37
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sce03029]
    YJL133W (MRS3)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YJL133W (MRS3)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    YJL133W (MRS3)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YJL133W (MRS3)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 853308
NCBI-ProteinID: NP_012402
SGD: S000003669
UniProt: P10566
Position
X:160619..161563
AA seq 314 aa
MVENSSSNNSTRPIPAIPMDLPDYEALPTHAPLYHQLIAGAFAGIMEHSVMFPIDALKTR
IQSANAKSLSAKNMLSQISHISTSEGTLALWKGVQSVILGAGPAHAVYFGTYEFCKKNLI
DSSDTQTHHPFKTAISGACATTASDALMNPFDTIKQRIQLNTSASVWQTTKQIYQSEGLA
AFYYSYPTTLVMNIPFAAFNFVIYESSTKFLNPSNEYNPLIHCLCGSISGSTCAAITTPL
DCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAIS
WTAYECAKHFLMTY
NT seq 945 nt   +upstreamnt  +downstreamnt
atggtagaaaactcgtcgagtaataattcaacaaggccaattccagcaatacctatggat
ctacccgattatgaggcgctccccacccacgcgccattgtaccatcaacttatagcgggt
gcatttgctggtataatggaacattcagtgatgttcccgatagatgcccttaagacgcga
atacaatcagccaacgcgaaatcgctgtctgccaagaatatgctttcgcaaatatctcac
atctctacttccgaaggaactctagccctatggaagggtgttcagtctgtcatactaggt
gcgggacctgcgcatgcagtgtattttggtacgtatgagttctgcaaaaaaaatcttatc
gattcgagtgatacgcaaacgcaccatccttttaagacagctatcagtggtgcctgtgcc
accacggcatctgacgcattaatgaacccattcgacacaataaaacagagaatccaactc
aatacctcggcatcagtatggcaaaccacaaagcagatttaccaatctgaaggtttggca
gcattttattattcttacccaaccaccctagtaatgaacatcccatttgcagcatttaat
ttcgtcatatatgaatcatccacaaaatttttaaacccatcaaatgagtacaaccccctc
atacattgtctgtgtggcagtatcagcggatcgacatgtgcggcgatcacaacaccttta
gactgcataaagacagtactgcagataaggggcagtcaaacagtttcgttggaaattatg
agaaaggcggatacttttagtaaagcagccagtgccatatatcaagtttatggctggaaa
gggttttggagaggttggaaaccaaggatagtggcaaacatgccggctactgctatatca
tggacagcttatgaatgtgcaaaacatttcctaatgacgtattag

DBGET integrated database retrieval system