KEGG   Saccharomyces cerevisiae (budding yeast): YJL137CHelp
Entry
YJL137C           CDS       T00005                                 

Gene name
GLG2
Definition
(RefSeq) glycogenin glucosyltransferase GLG2
  KO
K00750  glycogenin [EC:2.4.1.186]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00500  Starch and sucrose metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
Module
sce_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YJL137C (GLG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sce01003]
    YJL137C (GLG2)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.186  glycogenin glucosyltransferase
     YJL137C (GLG2)
Glycosyltransferases [BR:sce01003]
 Polysaccharide
  Storage polysaccharide
   YJL137C (GLG2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_8
Motif
Other DBs
NCBI-GeneID: 853304
NCBI-ProteinID: NP_012398
SGD: S000003673
UniProt: P47011
Position
X:complement(154985..156127)
Genome map
AA seq 380 aa AA seqDB search
MAKKVAICTLLYSRDYLPGALTLAYQLQKLLKHAVVEDEITLCLLIEKKLFGDEFKPQEI
ALIRSLFKEIIIIEPLKDQEKSIEKNKANLELLKRPELSHTLLKARLWELVQFDQVLFLD
ADTLPLNKEFFEILRLYPEQTRFQIAAVPDIGWPDMFNTGVLLLIPDLDMATSLQDFLIK
TVSIDGADQGIFNQFFNPICNYSKEVLHKVSPLMEWIRLPFTYNVTMPNYGYQSSPAMNF
FQQHIRLIHFIGTFKPWSRNTTDYDDHYYQLWRSTQRELYSECHLSNYFTHLQLGNIETE
TNFYHEPPCLQDLLNHGKRENQKHVDLDITSVDRNASQKSTAEKHDIEKPTSKPQSAFKF
DWESTDYLDRVQRAFPKPDT
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaaagttgccatctgtacattgctgtattcacgggactatttacctggcgca
ttgactttagcgtaccaattacaaaaactcttgaaacacgctgtagtggaagatgagata
accttatgcctgctaattgaaaaaaaattgtttggagatgagtttaaacctcaggaaata
gctttaattagaagtctttttaaagagattatcattattgaaccgctaaaggatcaagag
aagagcatagagaagaataaggcaaatcttgaactgttgaaaaggcctgagctatctcat
actttactcaaggctagactgtgggaactggtgcagttcgatcaggttttatttttagat
gctgatactttaccattaaataaagaattttttgaaatcctacgattataccctgaacaa
acaagattccagattgctgcggttccagacatcggatggcctgacatgttcaacaccggt
gtactactactaattcctgatttagatatggcaacaagtttacaagattttttgattaaa
actgtatcgattgatggtgctgatcaaggaatcttcaatcaattttttaatcctatttgc
aactacagcaaagaggttttgcataaggtgtctccactcatggaatggatacgcctcccc
ttcacctacaacgtaaccatgcccaactacggataccagtcttcaccagccatgaatttt
ttccaacaacacatcagacttattcacttcattggaacgtttaagccatggtcccgtaat
acaactgactatgacgaccactattaccagctgtggagaagtacacagcgtgaactttat
agtgaatgccacttaagtaactacttcacacacttgcaattgggcaatattgaaacagag
acaaatttttaccacgaacctccttgtcttcaagacctgttgaatcatggtaaaagagaa
aatcaaaagcacgttgacctggatataacctcagtagatcgaaatgcttcgcagaagagt
actgcagagaaacatgatattgagaaaccgacatctaagccgcaatctgcttttaaattt
gattgggagtctacggattatttagaccgcgtccaaagagcattcccaaagcctgatacc
tga

DBGET integrated database retrieval system