KEGG   Saccharomyces cerevisiae (budding yeast): YJL148WHelp
Entry
YJL148W           CDS       T00005                                 

Gene name
RPA34, CST21
Definition
(RefSeq) DNA-directed RNA polymerase I subunit RPA34
  KO
K03003  DNA-directed RNA polymerase I subunit RPA34
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03020  RNA polymerase
Module
sce_M00182  RNA polymerase I, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    YJL148W (RPA34)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YJL148W (RPA34)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     YJL148W (RPA34)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_polI_A34 VIR_N
Motif
Other DBs
NCBI-GeneID: 853293
NCBI-ProteinID: NP_012387
SGD: S000003684
UniProt: P47006
Structure
PDB: 

Position
X:140437..141138
Genome map
AA seq 233 aa AA seqDB search
MSKLSKDYVSDSDSDDEVISNEFSIPDGFKKCKHLKNFPLNGDNKKKAKQQQVWLIKFPS
NVDISKLKSLPVDFESSTTMTIDKHDYKIMDDTDIESSLTQDNLSNMTLLVPSESKESLK
IASTAKDNAPLQFDKVFSVSETAKIPAIDYSKVRVPRKDVPKVEGLKLEHFATGYDAEDF
HVAEEVKENKKEPKKRSHHDDEEESSEKKKKKKEKREKREKKDKKDKKKKHRD
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagctttcgaaagattacgtatcagattcagactctgatgatgaagtgatatca
aacgagttcagcataccagatggtttcaagaaatgtaaacatttaaagaatttccctctc
aacggtgataacaaaaaaaaagcgaaacagcaacaggtttggctgatcaaattcccatca
aatgtggacatctccaagttaaaatctctgcctgtagattttgaatcctctacaaccatg
acaattgataaacacgattataaaatcatggacgatacagatattgagtcctcgttaaca
caggataacctcagtaatatgactttattggttccttcggaaagtaaggaaagtcttaaa
attgctagcactgccaaggataatgcaccattacagtttgacaaggtattttctgtcagc
gaaaccgctaaaatcccagctattgattacagtaaggtaagagttccacgtaaagatgtt
ccaaaagtagaaggcttgaagttggagcattttgctactggttatgatgccgaagatttc
catgtggctgaggaagttaaagaaaataagaaagaaccaaagaagcgttcacatcacgac
gatgaagaggagtctagtgaaaagaagaaaaagaagaaggagaagagggagaagagggag
aagaaggataaaaaggataagaaaaagaaacatagagattga

DBGET integrated database retrieval system