KEGG   Saccharomyces cerevisiae (budding yeast): YJL154CHelp
Entry
YJL154C           CDS       T00005                                 

Gene name
VPS35, GRD9, VPT7
Definition
(RefSeq) retromer subunit VPS35
  KO
K18468  vacuolar protein sorting-associated protein 35
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YJL154C (VPS35)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YJL154C (VPS35)
Membrane trafficking [BR:sce04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    YJL154C (VPS35)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Vps35
Motif
Other DBs
NCBI-GeneID: 853287
NCBI-ProteinID: NP_012381
SGD: S000003690
UniProt: P34110
Position
X:complement(131101..133935)
Genome map
AA seq 944 aa AA seqDB search
MAYADSPENAIAVIKQRTALMNRCLSQHKLMESLQHTSIMLTELRNPNLSPKKYYELYVI
IFDSLTNLSTYLIENHPQNHHLADLYELVQYTGNVVPRLYLMITVGTSYLTFNEAPKKEI
LKDMIEMCRGVQNPIRGLFLRYYLSQRTKELLPEDDPSFNSQFIMNNFIEMNKLWVRLQH
QGPLRERETRTRERKELQILVGSQLVRLSQIIDDNFQMYKQDILPTILEQVIQCRDLVSQ
EYLLDVICQVFADEFHLKTLDTLLQTTLHLNPDVSINKIVLTLVDRLNDYVTRQLEDDPN
ATSTNAYLDMDVFGTFWDYLTVLNHERPDLSLQQFIPLVESVIVLSLKWYPNNFDNLNKL
FELVLQKTKDYGQKNISLESEHLFLVLLSFQNSKLQLTSSTTAPPNSPVTSKKHFIFQLI
SQCQAYKNILALQSISLQKKVVNEIIDILMDREVEEMADNDSESKLHPPGHSAYLVIEDK
LQVQRLLSICEPLIISRSGPPANVASSDTNVDEVFFNRHDEEESWILDPIQEKLAHLIHW
IMNTTSRKQTMKNKIQFSLEAQLEILLLIKSSFIKGGINVKYTFPAIITNFWKLMRKCRM
IQEYLLKKRPDNKTLLSHYSNLLKQMFKFVSRCINDIFNSCNNSCTDLILKLNLQCAILA
DQLQLNEISYDFFSQAFTIFEESLSDSKTQLQALIYIAQSLQKTRSLYKEAYYDSLIVRC
TLHGSKLLKKQDQCRAVYLCSHLWWATEISNIGEEEGITDNFYRDGKRVLECLQRSLRVA
DSIMDNEQSCELMVEILNRCLYYFIHGDESETHISIKYINGLIELIKTNLKSLKLEDNSA
SMITNSISDLHITGENNVKASSNADDGSVITDKESNVAIGSDGTYIQLNTLNGSSTLIRG
VVATASGSKLLHQLKYIPIHHFRRTCEYIESQREVDDRFKVIYV
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatgcggactcaccagaaaatgcgatcgctgttatcaagcagcgaaccgcacta
atgaaccggtgtctatctcaacacaaactaatggaatcattacagcatacttccataatg
ttgaccgaattgagaaatccaaacttatcgccgaagaaatactacgaactttatgtcatt
attttcgactcattgactaatctatctacgtacctcatagaaaaccatcctcaaaatcac
cacttagctgatctttatgagttggttcaatataccggtaacgtggtacccaggctttac
ttgatgatcacagttgggaccagctatctcactttcaatgaagcgcccaagaaggaaatc
ttaaaggatatgattgagatgtgtcgtggtgtgcaaaacccaataagaggtttgttttta
cgctattatttatcccagagaaccaaagaattacttccggaggacgatccgtcgtttaac
tctcaatttattatgaataatttcatcgagatgaacaagttgtgggtgagattacaacac
caggggccacttcgtgagagggaaaccagaacacgtgaaagaaaagagctgcaaatttta
gtggggtctcaactagtacgtctttcgcagattattgatgataatttccaaatgtataag
caagatattcttcccaccattttggaacaagtcatacaatgtagagatttagtatcccaa
gaatatcttttggacgtcatctgccaagtgttcgcagacgagttccatttgaaaaccttg
gatactttactgcaaactactttgcatttgaaccctgatgtttcgataaacaagattgtt
ctcactttggtcgatcgattaaacgattatgttacaagacagttggaggacgatccaaac
gccacctccacgaatgcttatttagatatggacgtgtttggtacgttctgggactatttg
accgtattgaatcatgaaagaccagatctatcattacaacagtttattcctctagttgag
agtgtgattgttttaagtttgaaatggtatcctaataattttgataatttgaacaaactc
tttgaattagtcttacaaaaaactaaggattatggtcagaaaaatatttctttagagtcc
gagcatttatttttggttctgttatctttccagaatagtaaacttcagctaacctcatcg
accactgcgccaccaaactcaccagttacttcgaaaaagcattttatctttcaattaatc
tcccagtgccaggcttacaaaaacatcctggctttgcagagcattagtctacaaaaaaaa
gttgtcaatgaaattattgacatcttaatggatagagaagtggaagaaatggccgataat
gattcagaatcgaaactgcatcctccagggcattccgcttatttagttattgaggacaaa
ctccaagttcagcgcctgctttcaatctgtgagcccttaataatatcaagaagcggaccg
cccgcaaatgttgcatcctcggatacaaatgtagacgaagtgttttttaatcgacatgat
gaagaagaatcctggatactggacccaatacaggaaaagttggcacatttgattcattgg
ataatgaacactacttctcggaaacaaacaatgaaaaacaaaattcaatttagcttagaa
gcccaattggaaatattacttcttattaaatcttcgttcattaaaggtggcatcaatgtt
aaatacacttttccagcaataatcacaaatttttggaaactgatgaggaaatgccgtatg
atacaagagtaccttttgaaaaaaagacccgataacaagacgttactttcccattattcc
aatcttttaaagcaaatgtttaaatttgtttctcgttgtatcaatgatatctttaattct
tgcaacaactcatgcacagatctgattctgaaactgaatttacaatgtgccattctagct
gatcaattgcaattaaacgaaatttcatatgattttttctcacaggccttcacaatattt
gaagagtctctaagtgattcaaagactcagttacaggctttaatatatattgctcagtct
ttacaaaagacaagatcactctacaaagaagcttattatgattctttgattgtcagatgc
acactccatggatccaaattattaaagaaacaagaccaatgtcgtgctgtttatttatgc
tcccacctctggtgggcaacggaaatttcaaatattggtgaggaagaaggtatcacagac
aacttctacagagatggtaaacgggtgttagaatgtctacaaaggtctctccgtgtggcg
gattctataatggataacgaacagagttgtgagctaatggtcgaaatattaaatagatgc
ctctactattttattcacggggatgagtccgaaactcatatatcgataaaatacatcaat
ggtctgatcgaactaatcaaaacaaacttaaaatcgctaaaactagaagataacagtgcc
tctatgattaccaactcaatcagtgatttgcacatcaccggagaaaataatgtgaaggca
agcagtaatgctgacgatggctctgtaatcacagataaggaatcaaatgttgccatagga
tcggatggtacgtatattcaattaaatactctgaacggatcttccacgctaatacgcgga
gtcgtagcaactgcttcaggtagtaaattactgcaccaactgaagtatatcccaatccac
cattttcgacgcacttgtgagtacattgaaagtcaaagagaagttgacgatcgtttcaaa
gtcatatatgtatag

DBGET integrated database retrieval system