KEGG   Saccharomyces cerevisiae (budding yeast): YJL159WHelp
Entry
YJL159W           CDS       T00005                                 

Gene name
HSP150, CCW7, ORE1, PIR2
Definition
(RefSeq) heat shock protein HSP150
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIR
Motif
Other DBs
NCBI-GeneID: 853281
NCBI-ProteinID: NP_012376
SGD: S000003695
UniProt: P32478
Position
X:120449..121690
Genome map
AA seq 413 aa AA seqDB search
MQYKKTLVASALAATTLAAYAPSEPWSTLTPTATYSGGVTDYASTFGIAVQPISTTSSAS
SAATTASSKAKRAASQIGDGQVQAATTTASVSTKSTAAAVSQIGDGQIQATTKTTAAAVS
QIGDGQIQATTKTTSAKTTAAAVSQISDGQIQATTTTLAPKSTAAAVSQIGDGQVQATTT
TLAPKSTAAAVSQIGDGQVQATTKTTAAAVSQIGDGQVQATTKTTAAAVSQIGDGQVQAT
TKTTAAAVSQIGDGQVQATTKTTAAAVSQITDGQVQATTKTTQAASQVSDGQVQATTATS
ASAAATSTDPVDAVSCKTSGTLEMNLKGGILTDGKGRIGSIVANRQFQFDGPPPQAGAIY
AAGWSITPDGNLAIGDNDVFYQCLSGTFYNLYDEHIGSQCTPVHLEAIDLIDC
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacaaaaagactttggttgcctctgctttggccgctactacattggccgcctat
gctccatctgagccttggtccactttgactccaacagccacttacagcggtggtgttacc
gactacgcttccaccttcggtattgccgttcaaccaatctccactacatccagcgcatca
tctgcagccaccacagcctcatctaaggccaagagagctgcttcccaaattggtgatggt
caagtccaagctgctaccactactgcttctgtctctaccaagagtaccgctgccgccgtt
tctcagatcggtgatggtcaaatccaagctactactaagactaccgctgctgctgtctct
caaattggtgatggtcaaattcaagctaccaccaagactacctctgctaagactaccgcc
gctgccgtttctcaaatcagtgatggtcaaatccaagctaccaccactactttagcccca
aagagcaccgctgctgccgtttctcaaatcggtgatggtcaagttcaagctaccaccact
actttagccccaaagagcaccgctgctgccgtttctcaaatcggtgatggtcaagttcaa
gctactactaagactaccgctgctgctgtctctcaaattggtgatggtcaagttcaagct
accaccaagactactgctgccgccgtttctcaaatcggtgatggtcaagttcaagctact
accaagactaccgctgctgctgtctctcaaatcggtgatggtcaagttcaagcaactacc
aaaaccactgccgcagctgtttcccaaattactgacggtcaagttcaagccactacaaaa
accactcaagcagccagccaagtaagcgatggccaagtccaagctactactgctacttcc
gcttctgcagccgctacctccactgacccagtcgatgctgtctcctgtaagacttctggt
accttagaaatgaacttaaagggcggtatcttaactgacggtaagggtagaattggttct
attgttgctaacagacaattccaatttgacggtccaccaccacaagctggtgccatctac
gctgctggttggtctataactccagacggtaacttggctattggtgacaatgatgtcttc
taccaatgtttgtccggtactttctacaacttgtacgacgaacacattggtagtcaatgt
actccagtccacttggaagctatcgatttgatagactgttaa

DBGET integrated database retrieval system