KEGG   Saccharomyces cerevisiae (budding yeast): YJL165CHelp
Entry
YJL165C           CDS       T00005                                 

Gene name
HAL5
Definition
(RefSeq) protein kinase HAL5
  KO
K08286  protein-serine/threonine kinase [EC:2.7.11.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YJL165C (HAL5)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     YJL165C (HAL5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 853274
NCBI-ProteinID: NP_012370
SGD: S000003701
UniProt: P38970
Position
X:complement(106894..109461)
Genome map
AA seq 855 aa AA seqDB search
MGDEKLSRHTSLKRARSLSESIKGLFKPSGISGSNNAAAPSSRPGQDQAHSHQTARIITS
NVSSPSISPVHSPVLQAAPKHHKLGVPNIAKLSLSPSREPSLNSENEMFSQESFISEKDE
DEANLLEREDLQNKKEEKARAKHVRSKEAYVPHHRYTVGSDEVERQPRERLKNFPQNAGS
SNPANSNANHVLDQENNFSIDAMLDYDEESKLRRRNSLGVRNHSNRTRSRKNSLSTPRSP
PMKNGNGGMNSNATNNVGNGTGNRIYMRGRNHSDSISASSLPKFQEIECKCILDLGHFKV
FENGYHEHSLRVLPIITNNKNVDSGDEKDADASVNSGDDGDNDSEANMHKQKSVFSLSGL
FKSHKDGNQQQQQQQQQEENGEQINLEKAFSIIPSQRFIKSQTLKKSRTSNLKNGNNDEL
MKNDGKNIPQIVNPNAAVGVEELKLINALSEKIRKGLKSENTKGNNGEGRSNSNKQEDSD
DTEGKAGTTNDDTSHKPCSQKYGKSIGVVGAGAYGVVKICARCKTAKDVLPYSTYSNGKK
LFFAVKELKPKPGDQIDKFCTRLTSEFIIGHSLSHPHFEANAMIAGNVSRTTPPKHVFNA
PNILKILDLMEYSNSFVEVMEFCASGDLYSLLTRNNISNESNNGSSRLIQTVKEGSGSPL
HPLEADCFMKQLLNGVQYMHDHGIAHCDLKPENILFQPNGLLKICDFGTSSVFQTAWEKH
VHFQSGAMGSEPYVAPEEFIRDAEYDPRLVDCWSCGIVYCTMVMGQYLWKIAIPEKDSLF
KSFLSEIKDDGQFYLFEELRHVSSELNRLRKIALYRTFQVDPTKRITIEQLLQSSWMRKT
KCCVVYRHLHTKVSK
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgagaagctttcacgccacacatctttgaagagggccagatcgctctccgaa
tccattaagggtctatttaagccttcagggatatcaggcagtaataatgctgcggctcct
tcatctcgtcccggtcaggaccaagcacattctcatcaaacagcaagaataataactagc
aacgtatcttccccgtctatatcccccgtacatagccctgttctacaagcggctcctaag
catcacaaactgggcgtccctaatattgcaaaactctcgttgtcacctagtagggaacca
tctttgaattcagaaaatgaaatgttttcacaagaatctttcataagtgaaaaagatgaa
gatgaagccaatttgttagagagagaggatcttcaaaataaaaaggaagagaaagctcgt
gcaaaacatgtacgttccaaggaagcttatgtgcctcatcaccgctatacagttggtagc
gatgaggttgaaagacaaccaagggaacggctgaaaaacttcccacaaaacgcaggttct
tcaaaccctgcaaatagtaatgccaaccatgttttggatcaggaaaataacttttctatt
gatgctatgcttgattatgacgaagaatcaaaacttagaaggagaaacagtctgggcgta
cgtaatcatagcaatcgcacaagaagtaggaagaacagtttgtccacaccaaggtcacca
ccaatgaaaaatggaaatggtggaatgaattcaaatgccaccaacaatgttggtaatggt
acaggaaatagaatatacatgaggggaagaaatcactcagactctatcagtgcttccagc
ttaccgaaatttcaagaaatcgaatgtaaatgtattttggatttaggtcatttcaaagtc
tttgaaaacggataccacgaacattctttgagagtgctgccaattattacaaacaataaa
aatgtggatagtggcgatgaaaaggatgctgacgcttctgtaaacagcggcgatgatggt
gacaatgacagtgaggcaaatatgcataaacaaaaatctgtgttttctttaagtggatta
ttcaaatctcataaggatggaaaccaacaacagcagcaacagcagcaacaagaagaaaac
ggcgaacaaatcaatctagaaaaagcattttcaataataccatcccagagattcatcaaa
tcgcagactttaaagaaatcgagaacgagtaaccttaaaaatggcaataatgatgaattg
atgaaaaacgatggtaaaaatattccgcaaatcgtgaatcctaacgctgctgtaggtgtt
gaagagttgaagctaatcaatgcattatcggaaaaaatacgaaagggccttaaaagtgaa
aatacaaaaggcaacaatggcgaaggcagaagcaatagcaataaacaggaggattctgat
gacacagagggcaaggcaggaacaaccaatgacgatacatctcataaaccttgttcacaa
aaatacggaaaatctattggggtcgtcggtgcaggtgcatacggggtggtcaaaatttgc
gcaaggtgcaagactgctaaagatgtcctaccatacagtacctactctaatggaaaaaaa
ctattctttgccgtcaaagagctgaagcccaagccaggtgaccaaattgataaattttgc
acgagattaacctctgagttcattattggacactcactgagccatccgcattttgaggca
aatgcgatgatagcaggaaatgtttcaagaaccactccaccaaaacatgtcttcaatgcc
ccaaacattttgaaaattttggacctaatggaatatagcaattccttcgtagaagtgatg
gaattttgtgcttcaggtgatttatattcgttgctaacaaggaataacatctcaaatgaa
tcgaataacgggagttcaagattgatccaaactgttaaagaaggttctgggagtccgttg
cacccattagaagcagactgttttatgaaacagcttttgaatggtgttcaatacatgcat
gatcatggtatagcacactgtgatttgaaacccgaaaatatccttttccaacctaatggg
ttgttaaaaatttgtgattttggtactagttcagtttttcagactgcctgggagaaacac
gtccacttccagagtggagccatgggttcagagccatatgtggcacctgaagaatttata
agggatgcagaatacgatccgcgtctggtagattgttggagttgtggtattgtttactgt
acaatggtcatgggacagtatctttggaaaatcgccattcctgaaaaggattctcttttt
aaatcatttctcagtgaaattaaagatgatggacagttttatctatttgaggaattaaga
catgttagtagcgaactgaataggttgaggaaaattgcactatatagaacgttccaggtc
gaccccacgaagagaatcaccattgaacaattactacaaagctcctggatgaggaaaaca
aaatgctgtgtagtttatagacacttacataccaaggttagtaaataa

DBGET integrated database retrieval system