KEGG   Saccharomyces cerevisiae (budding yeast): YJL166WHelp
Entry
YJL166W           CDS       T00005                                 

Gene name
QCR8, COR5
Definition
(RefSeq) ubiquinol--cytochrome-c reductase subunit 8
  KO
K00418  ubiquinol-cytochrome c reductase subunit 8
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00190  Oxidative phosphorylation
sce01100  Metabolic pathways
Module
sce_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YJL166W (QCR8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UcrQ Cyt_b-c1_8
Motif
Other DBs
NCBI-GeneID: 853273
NCBI-ProteinID: NP_012369
SGD: S000003702
UniProt: P08525
Structure
PDB: 

Position
X:106434..106718
Genome map
AA seq 94 aa AA seqDB search
MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVL
IPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgggtcctccaagcggtaaaacttacatgggatggtggggtcacatgggtggtccaaag
caaaaaggtataacctcatatgctgtgtctccatatgctcaaaagccattacaaggtatt
ttccataacgctgtattcaatagttttagaagatttaagtctcaatttctatatgtatta
atacctgcgggaatttattggtactggtggaagaacggtaacgagtataatgaatttctg
tacagcaaagctggtagagaagagctggaaagagttaatgtttaa

DBGET integrated database retrieval system