KEGG   Saccharomyces cerevisiae (budding yeast): YJL177W
Entry
YJL177W           CDS       T00005                                 

Gene name
RPL17B
Definition
(RefSeq) ribosomal 60S subunit protein L17B
  KO
K02880  large subunit ribosomal protein L17e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YJL177W (RPL17B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YJL177W (RPL17B)
Ribosome [BR:sce03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    YJL177W (RPL17B)
SSDB
Motif
Pfam: Ribosomal_L22
Other DBs
NCBI-GeneID: 853262
NCBI-ProteinID: NP_012358
SGD: S000003713
UniProt: P46990
Position
X:join(90786..91094,91412..91657)
AA seq 184 aa
MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLDQVLDHQRAIPF
RRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAANAEAKGLDATKLYVSHIQVN
QAPKQRRRTYRAHGRINKYESSPSHIELVVTEKEEAVAKAAEKKVVRLTSRQRGRIAAQK
RISA
NT seq 555 nt   +upstreamnt  +downstreamnt
atggcaagatacggtgctacttcaaccaacccagctaaatctgcgtcagctcgtggttct
tatttgcgtgtttctttcaagaacaccagggaaactgctcaagccattaatggttgggaa
ttgactaaggctcaaaaatacttggaccaagttttggaccaccaaagagccatcccattc
agaagatttaactcctctattggtagaactgcccaaggtaaggaatttggtgtcaccaag
gctagatggccagctaaatctgttaagttcgttcaaggtttgttgcaaaacgccgctgcc
aatgctgaagctaagggtctagatgctaccaagttgtacgtttctcacatccaagttaac
caagcaccaaagcaaagaagaagaacttacagagcccacggtagaatcaacaagtacgaa
tcttctccatctcacattgaattggttgttaccgaaaaggaagaagctgtcgccaaggct
gctgaaaagaaggttgtcagattgacttctagacaaagaggtagaattgctgcccaaaaa
cgtatctctgcttaa

DBGET integrated database retrieval system