KEGG   Saccharomyces cerevisiae (budding yeast): YJL203WHelp
Entry
YJL203W           CDS       T00005                                 

Gene name
PRP21, SPP91
Definition
(RefSeq) Prp21p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Surp PRP21_like_P
Motif
Other DBs
NCBI-GeneID: 853227
NCBI-ProteinID: NP_012332
SGD: S000003739
UniProt: P32524
Structure
PDB: 

Position
X:53341..54183
Genome map
AA seq 280 aa AA seqDB search
MEPEDTQLKEDIKTTVNYIKQHGVEFENKLLEDERFSFIKKDDPLHEYYTKLMNEPTDTV
SGEDNDRKSEREIARPPDFLFSQYDTGISRRDMEVIKLTARYYAKDKSIVEQMISKDGEA
RLNFMNSSHPLHKTFTDFVAQYKRVYSFTGQEIKKSKRTILDNCFERTQYWEFEKDKDRE
HDKLVELCKIQFAAIPWDKFTQVAKFSIPEDTEIFEGSLDLEQMRLRRVQTGIKLFDSIK
PTNEEEKIVSDQGKQKGGDSKGKKRKIRAVGETRLKKSKK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggaaccagaagatacccagctgaaagaggacattaaaaccacagtaaattacataaag
cagcatggtgttgagtttgagaacaaactgctagaagatgagagattctcattcatcaag
aaagatgacccactccatgaatactacaccaaactcatgaatgagccaacagacactgtc
agcggtgaagataatgacagaaagagtgagcgagagatagcaaggccgccggattttctg
ttctctcaatatgatactggaatatcccgaagagacatggaagtaatcaaattgacagca
cgctactatgcaaaggataaaagtattgttgaacagatgatttcaaaggatggtgaagcc
agattaaactttatgaacagctcacatccgctacataagacattcactgattttgtcgcc
cagtacaagcgagtatattcttttactggtcaagaaatcaagaaaagtaagagaaccatt
ttagataattgttttgagagaacacagtattgggaatttgagaaagataaagaccgggaa
catgataagctcgtagagttgtgcaaaatacaatttgcagccattccatgggataaattt
actcaagtggcaaaattttctatccctgaagacacagaaatcttcgaaggctctctagat
ttagaacagatgaggctgcgaagagtacaaactggtattaagttattcgatagtatcaag
ccgacaaatgaagaagaaaagatagtatccgaccaaggtaagcaaaaaggaggagatagt
aagggcaaaaagcgtaaaattagagctgtgggagagacaaggttaaagaaaagtaaaaaa
taa

DBGET integrated database retrieval system