KEGG   Saccharomyces cerevisiae (budding yeast): YJL212C
Entry
YJL212C           CDS       T00005                                 

Gene name
OPT1, GSH11, HGT1
Definition
(RefSeq) oligopeptide transporter OPT1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: OPT
Other DBs
NCBI-GeneID: 853218
NCBI-ProteinID: NP_012323
SGD: S000003748
UniProt: P40897
Position
X:complement(33850..36249)
AA seq 799 aa
MSTIYRESDSLESEPSPTPTTIPIQINMEEEKKDAFVKNIDEDVNNLTATTDEEDRDPES
QKFDRHSIQEEGLVWKGDPTYLPNSPYPEVRSAVSIEDDPTIRLNHWRTWFLTTVFVVVF
AGVNQFFSLRYPSLEINFLVAQVVCYPIGRILALLPDWKCSKVPFFDLNPGPFTKKEHAV
VTIAVALTSSTAYAMYILNAQGSFYNMKLNVGYQFLLVWTSQMIGYGAAGLTRRWVVNPA
SSIWPQTLISVSLFDSLHSRKVEKTVANGWTMPRYRFFLIVLIGSFIWYWVPGFLFTGLS
YFNVILWGSKTRHNFIANTIFGTQSGLGALPITFDYTQVSQAMSGSVFATPFYVSANTYA
SVLIFFVIVLPCLYFTNTWYAKYMPVISGSTYDNTQNKYNVTKILNEDYSINLEKYKEYS
PVFVPFSYLLSYALNFAAVIAVFVHCILYHGKDIVAKFKDRKNGGTDIHMRIYSKNYKDC
PDWWYLLLQIVMIGLGFVAVCCFDTKFPAWAFVIAILISLVNFIPQGILEAMTNQHVGLN
IITELICGYMLPLRPMANLLFKLYGFIVMRQGLNLSRDLKLAMYMKVSPRLIFAVQIYAT
IISGMVNVGVQEWMMHNIDGLCTTDQPNGFTCANGRTVFNASIIWSLPKYLFSSGRIYNP
LMWFFLIGLLFPLAVYAVQWKFPKFKFAKHIHTPVFFTGPGNIPPSTPYNYSLFFAMSFC
LNLIRKRWRAWFNKYNFVMGAGVEAGVAISVVIIFLCVQYPGGKLSWWGNNVWKRTYDND
YKKFYTLKKGETFGYDKWW
NT seq 2400 nt   +upstreamnt  +downstreamnt
atgagtaccatttatagggagagcgactcgttggagtcggagccctcgccaacgccaaca
accattcctatccagatcaatatggaagaggaaaagaaagatgctttcgttaagaatatt
gacgaggacgtcaataatctcactgcgactactgatgaggaggaccgcgatccggaaagc
caaaaattcgacaggcattccatacaggaggaaggtctcgtttggaagggcgaccctaca
tacttgcccaattctccatatcctgaagtgagatcggcggtgtccatcgaggatgacccc
accatccgcctcaaccactggagaacgtggttcttgaccacggtgtttgtggtagttttc
gccggtgttaatcaatttttttccctgagatatccatcgctagagatcaacttccttgtt
gcacaagttgtttgctacccaattggtaggatactggctctcttgcccgactggaagtgt
tctaaagtgccatttttcgatttaaacccgggcccatttaccaaaaaggaacacgccgtg
gtcacaattgccgtggcgcttacttcctctactgcatacgctatgtacattttgaacgcc
cagggaagcttttacaacatgaaacttaatgtcggatatcagttcttgttggtttggaca
tctcaaatgattggttatggtgctgcaggtcttaccagaagatgggtcgtcaaccctgca
agctctatctggcctcagactttaatttcagtgtccttgtttgattcgttgcactcgaga
aaagttgaaaagacagtcgcaaatggttggacgatgccccgttacaggttcttcttaatc
gtccttatcggatcgttcatctggtattgggtacctggattcctctttaccggtctgtcc
tatttcaacgttatcctatgggggtcgaagacaagacacaatttcatcgctaacacaatc
tttggtactcaaagtggtctcggtgcgttgccaattacatttgactacacccaggtttcc
caagccatgtccggctctgttttcgccacaccattctacgtctccgccaacacctatgca
tcagtgttgatattcttcgtcatagtgctgccatgtctttattttacgaatacctggtat
gccaaatacatgcccgtcatttcaggttctacttatgacaacactcaaaacaaatacaac
gtaacaaagattcttaacgaggattattccattaatcttgagaaatataaggaatactca
ccggtattcgttccattttcctatcttttgtcgtatgctttaaattttgccgctgttatc
gccgtttttgtccactgcatcttataccacggtaaagatattgtcgccaagtttaaagac
cgtaaaaatggtggcactgacattcacatgagaatctactccaagaactataaggattgt
cccgattggtggtatttacttttgcagattgtcatgatcggtttaggatttgtagcagtg
tgctgtttcgatactaagttcccagcttgggcatttgttattgcaatattaatttccctt
gtaaatttcatcccgcaaggtatcttggaagcaatgactaaccaacacgtaggtttgaat
attatcacagaattgatctgcggttatatgctgcctttaagaccaatggcaaacttatta
ttcaagctatacggatttattgtcatgagacaaggcttgaatttgagtagagatttgaaa
ttagccatgtacatgaaggtttcccctcgtttgatctttgccgttcaaatctatgccact
atcatatcaggcatggttaacgttggtgtccaggaatggatgatgcataatatcgatggc
ttatgtaccaccgatcaaccaaatggcttcacttgtgctaatggtcgcacggttttcaat
gcttccattatctggtctttgccaaagtatcttttctcatcagggcgcatttataatccg
ctgatgtggttcttcttgattggtttgctattcccactagccgtttatgctgttcaatgg
aaattccctaaatttaaatttgctaagcacattcatactcctgtatttttcacaggccca
ggtaatattccaccaagcacaccttataactactcattattttttgcaatgtcattctgc
ctaaacttgataagaaaaagatggagagcttggttcaataagtacaatttcgtcatgggg
gccggtgttgaagcaggtgtggcaatctccgtcgtcatcatcttcttgtgtgtacagtac
ccaggtggtaagctcagctggtggggaaacaacgtttggaaaagaacgtatgataatgat
tataaaaaattttataccttaaagaaaggtgagacatttggttatgataaatggtggtaa

DBGET integrated database retrieval system