KEGG   Saccharomyces cerevisiae (budding yeast): YJR019C
Entry
YJR019C           CDS       T00005                                 

Gene name
TES1, PTE1
Definition
(RefSeq) palmitoyl-CoA hydrolase
  KO
K01068  acyl-coenzyme A thioesterase 1/2/4 [EC:3.1.2.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00062  Fatty acid elongation
sce01040  Biosynthesis of unsaturated fatty acids
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    YJR019C (TES1)
   01040 Biosynthesis of unsaturated fatty acids
    YJR019C (TES1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sce01004]
    YJR019C (TES1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     YJR019C (TES1)
Lipid biosynthesis proteins [BR:sce01004]
 Fatty acid synthase
  Component type
   YJR019C (TES1)
SSDB
Motif
Pfam: Acyl_CoA_thio 4HBT_3
Other DBs
NCBI-GeneID: 853477
NCBI-ProteinID: NP_012553
SGD: S000003780
UniProt: P41903
Structure
PDB: 
1TBU

Position
X:complement(467232..468281)
AA seq 349 aa
MSASKMAMSNLEKILELVPLSPTSFVTKYLPAAPVGSKGTFGGTLVSQSLLASLHTVPLN
FFPTSLHSYFIKGGDPRTKITYHVQNLRNGRNFIHKQVSAYQHDKLIFTSMILFAVQRSK
EHDSLQHWETIPGLQGKQPDPHRYEEATSLFQKEVLDPQKLSRYASLSDRFQDATSMSKY
VDAFQYGVMEYQFPKDMFYSARHTDELDYFVKVRPPITTVEHAGDESSLHKHHPYRIPKS
ITPENDARYNYVAFAYLSDSYLLLTIPYFHNLPLYCHSFSVSLDHTIYFHQLPHVNNWIY
LKISNPRSHWDKHLVQGKYFDTQSGRIMASVSQEGYVVYGSERDIRAKF
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgagtgcttccaaaatggccatgtccaacctagagaaaatattggaactggttcctctt
tcgcctaccagttttgtcacaaagtatctgcctgccgcgcccgtagggtctaagggcact
tttggtggaacgctggtatcacaatcgctgctggcgtcattgcatactgtgccattgaac
ttcttccccacatcgctacattcgtatttcatcaagggtggtgatccgcggaccaagatc
acgtaccatgtgcagaatctgagaaacggtagaaatttcatccataagcaggttagtgct
tatcagcacgacaagttgatatttacgtcgatgatcttatttgccgtgcaacggtccaag
gagcacgactccttgcagcactgggagacgattccaggcctgcaaggtaagcagccagac
cctcatcgttatgaagaggccacttcgcttttccagaaagaagttctggacccacagaaa
ttgagcaggtatgcctcattgtccgacaggttccaagacgcaacctcgatgagcaagtat
gtggatgcgtttcaatacggagtcatggagtaccaattccccaaggacatgttctactcg
gcaagacacaccgacgagctggattatttcgtcaaagtgagacctcccatcactaccgtg
gagcacgcgggcgacgagtcttctttacacaagcatcatccgtacaggatcccgaagagc
attactcctgagaacgacgctcgctacaactacgtggcctttgcgtatctgtccgattcc
tacctcctactcacgatcccgtacttccacaacctgcctttgtactgccacagtttcagt
gtctcgctcgaccacacgatttactttcaccagttgcctcatgtgaacaattggatctat
cttaagatttcgaatcccaggtcccactgggacaagcacctcgtacagggcaagtatttc
gacacacagtcgggacgcatcatggcaagcgtctctcaggagggctacgttgtctacggg
tcagaacgagacattcgagccaagttctga

DBGET integrated database retrieval system