KEGG   Saccharomyces cerevisiae (budding yeast): YJR045C
Entry
YJR045C           CDS       T00005                                 
Symbol
SSC1, ENS1
Name
(RefSeq) Hsp70 family ATPase SSC1
  KO
K04043  molecular chaperone DnaK
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    YJR045C (SSC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YJR045C (SSC1)
   03110 Chaperones and folding catalysts [BR:sce03110]
    YJR045C (SSC1)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YJR045C (SSC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YJR045C (SSC1)
Messenger RNA biogenesis [BR:sce03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     YJR045C (SSC1)
Chaperones and folding catalysts [BR:sce03110]
 Heat shock proteins
  HSP70 / DNAK
   YJR045C (SSC1)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    YJR045C (SSC1)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    YJR045C (SSC1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YJR045C (SSC1)
  Exosomal proteins of breast cancer cells
   YJR045C (SSC1)
  Exosomal proteins of colorectal cancer cells
   YJR045C (SSC1)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Ploopntkinase3 DUF4473
Other DBs
NCBI-GeneID: 853503
NCBI-ProteinID: NP_012579
SGD: S000003806
UniProt: P0CS90
Position
X:complement(519638..521602)
AA seq 654 aa
MLAAKNILNRSSLSSSFRIATRLQSTKVQGSVIGIDLGTTNSAVAIMEGKVPKIIENAEG
SRTTPSVVAFTKEGERLVGIPAKRQAVVNPENTLFATKRLIGRRFEDAEVQRDIKQVPYK
IVKHSNGDAWVEARGQTYSPAQIGGFVLNKMKETAEAYLGKPVKNAVVTVPAYFNDSQRQ
ATKDAGQIVGLNVLRVVNEPTAAALAYGLEKSDSKVVAVFDLGGGTFDISILDIDNGVFE
VKSTNGDTHLGGEDFDIYLLREIVSRFKTETGIDLENDRMAIQRIREAAEKAKIELSSTV
STEINLPFITADASGPKHINMKFSRAQFETLTAPLVKRTVDPVKKALKDAGLSTSDISEV
LLVGGMSRMPKVVETVKSLFGKDPSKAVNPDEAVAIGAAVQGAVLSGEVTDVLLLDVTPL
SLGIETLGGVFTRLIPRNTTIPTKKSQIFSTAAAGQTSVEIRVFQGERELVRDNKLIGNF
TLAGIPPAPKGVPQIEVTFDIDADGIINVSARDKATNKDSSITVAGSSGLSENEIEQMVN
DAEKFKSQDEARKQAIETANKADQLANDTENSLKEFEGKVDKAEAQKVRDQITSLKELVA
RVQGGEEVNAEELKTKTEELQTSSMKLFEQLYKNDSNNNNNNNGNNAESGETKQ
NT seq 1965 nt   +upstreamnt  +downstreamnt
atgcttgctgctaaaaacatactaaacaggtcaagcttgtctagctctttccgtattgcc
acacgtttgcagtcaaccaaggttcaaggttccgtcatcggtatcgatttgggtaccacc
aactctgcggttgccattatggaaggtaaagttccaaaaattattgaaaacgccgaaggt
tccagaactactccttctgtagtagctttcactaaagagggagaacgtttggttggtatt
ccagccaagcgtcaagccgtagtgaacccagaaaacaccctatttgctaccaagcgtttg
attggtcgtcgtttcgaagacgctgaagtgcaaagagatatcaagcaagttccatacaag
atcgtcaagcactccaacggggatgcttgggttgaggccagaggtcaaacttactcacca
gcccaaatcggtgggttcgtcttgaacaagatgaaggaaacagctgaggcctacttgggt
aagccagttaagaatgctgttgtcactgtcccagcttatttcaacgactctcaaagacaa
gctactaaagacgcaggccaaattgttggtttgaacgttttacgtgtcgtcaatgaacca
accgccgctgccttagcttacggtttggaaaaatccgactctaaagttgttgccgttttc
gatttgggtggtggtactttcgatatctccatcttagatattgacaacggtgtttttgaa
gttaagtccactaacggtgacactcatttgggtggtgaagatttcgacatctatttgttg
agagagattgtttctcgtttcaagaccgaaactggtattgatttggaaaatgaccgtatg
gctatccaaagaattagagaagctgctgaaaaggctaagattgagctatcttctaccgtt
tccactgaaatcaacctgccatttatcactgctgatgcctcaggtccaaagcatatcaac
atgaagttctccagggctcaattcgagactttgacagccccactagttaagagaactgtc
gacccagtcaagaaggctttgaaagacgccggtttgtctacttcagacatatctgaagtc
ttattggtcggtggtatgtccagaatgcctaaggttgtcgaaaccgttaaatctttgttt
ggtaaggacccatctaaggccgtcaacccagatgaagctgttgccattggtgctgctgtg
caaggtgctgtcttgtccggtgaggttactgacgtcttattattagatgttaccccattg
tctctaggtatcgaaactttaggtggtgttttcacaagattgattccaagaaacactact
attccaacaaagaaatctcaaatcttctccactgccgctgctggtcaaacttctgttgaa
atcagagttttccaaggtgaaagagaattggttagagacaacaaattgattggtaacttc
actttagccggtatcccacctgctccaaagggtgtcccacaaatcgaagtcacttttgac
atcgatgccgatggtattattaacgtttctgctagagacaaagctacaaacaaagattct
tctattactgttgccggttcttctggtttgtccgaaaacgaaattgaacaaatggttaac
gacgctgaaaaattcaagtctcaagatgaagctagaaaacaagccatcgaaactgccaac
aaggctgaccaattggccaacgatactgaaaactccttgaaagaatttgaaggtaaggtt
gacaaggctgaagcccaaaaggttagggatcaaatcacttccttgaaggagttggttgct
agagtacaaggtggcgaagaggttaacgctgaggagttaaagaccaagaccgaagaattg
caaacttcctcgatgaaattgtttgaacaattatacaagaacgactctaacaacaacaac
aacaacaacggcaacaatgccgaatctggtgaaactaagcagtaa

DBGET integrated database retrieval system