KEGG   Saccharomyces cerevisiae (budding yeast): YJR063W
Entry
YJR063W           CDS       T00005                                 

Gene name
RPA12, RRN4
Definition
(RefSeq) DNA-directed RNA polymerase I core subunit RPA12
  KO
K03000  DNA-directed RNA polymerase I subunit RPA12
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    YJR063W (RPA12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YJR063W (RPA12)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     YJR063W (RPA12)
SSDB
Motif
Pfam: TFIIS_C RNA_POL_M_15KD DZR TF_Zn_Ribbon TackOD1 IBR zf-H2C2_2 zf-TFIIB DUF2072 GATA tRNA-synt_1f DUF3797 Nop10p zf-CSL zinc_ribbon_6 Zn_Tnp_IS1595 CpXC
Other DBs
NCBI-GeneID: 853526
NCBI-ProteinID: NP_012597
SGD: S000003824
UniProt: P32529
Structure
PDB: 

Position
X:555195..555572
AA seq 125 aa
MSVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSSL
RAKKSVVKTSLKKNELKDGATIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYK
FRTNN
NT seq 378 nt   +upstreamnt  +downstreamnt
atgtctgttgtaggatcgttaattttttgcttggactgtggtgatctcctggaaaatcct
aatgccgtattaggctctaacgttgaatgcagccaatgtaaagccatatatcccaagtca
caattctccaatttaaaagtcgtcaccacgacggcagacgatgcgtttccatcttctctt
agagccaagaaatccgtggttaaaacttctttgaagaagaacgaactgaaagacggcgct
actatcaaggaaaagtgtcctcagtgtggaaatgaagagatgaactatcatactttacag
ttaagatctgcagatgaaggtgctactgtcttctatacatgcacttcctgtggttacaag
ttccgtaccaacaattga

DBGET integrated database retrieval system