KEGG   Saccharomyces cerevisiae (budding yeast): YJR067CHelp
Entry
YJR067C           CDS       T00005                                 

Gene name
YAE1
Definition
(RefSeq) Yae1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Yae1_N Romo1
Motif
Other DBs
NCBI-GeneID: 853530
NCBI-ProteinID: NP_012601
SGD: S000003828
UniProt: P47118
Position
X:complement(567019..567444)
Genome map
AA seq 141 aa AA seqDB search
MSNTWDDVWASDSDVETERSPDLVKLRENHSKRGYLDGIVSSKEEKLQEGFNDGFPTGAK
LGKQVGIIMGILLGLRTRFGDEDEDLSKAYIDAQKELRINKVLSKSIFDPNFDLQEKHPL
ITKWTDIANTYCEKYHVPSIQ
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatacttgggacgatgtatgggcatcagacagtgatgtcgaaactgaacgatct
ccagatttagtgaagttaagagagaatcatagcaagagggggtacttggacggaatagtg
agttctaaagaagaaaagctgcaagagggtttcaatgatggtttcccaacgggcgctaaa
ttagggaaacaagttggcataattatggggattttacttggcctacgaacacgttttggt
gatgaagatgaggacctcagtaaggcatatattgatgctcaaaaagaattacgcattaac
aaagtacttagtaagtccatatttgatccaaactttgacttgcaagaaaaacatccgctc
ataacaaaatggactgatattgccaatacctattgtgaaaagtaccatgtgccatctatc
caataa

DBGET integrated database retrieval system