KEGG   Saccharomyces cerevisiae (budding yeast): YJR068WHelp
Entry
YJR068W           CDS       T00005                                 

Gene name
RFC2
Definition
(RefSeq) replication factor C subunit 2
  KO
K10755  replication factor C subunit 2/4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03420  Nucleotide excision repair
sce03430  Mismatch repair
Module
sce_M00289  RF-C complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YJR068W (RFC2)
   03420 Nucleotide excision repair
    YJR068W (RFC2)
   03430 Mismatch repair
    YJR068W (RFC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YJR068W (RFC2)
   03036 Chromosome and associated proteins [BR:sce03036]
    YJR068W (RFC2)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YJR068W (RFC2)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    YJR068W (RFC2)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     YJR068W (RFC2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    YJR068W (RFC2)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     YJR068W (RFC2)
  Check point factors
   HRAD17(Rad24)-RFC complex
    YJR068W (RFC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 RuvB_N AAA_22 AAA_11 AAA_assoc_2 AAA_14 AAA_16 Mg_chelatase ResIII DUF815 AAA_7 AAA_19 AAA_30 AAA_24 AAA_23 DNA_pol3_gamma3 AAA_5 AAA_3 TIP49 DUF2075 YAF2_RYBP AAA_18
Motif
Other DBs
NCBI-GeneID: 853531
NCBI-ProteinID: NP_012602
SGD: S000003829
UniProt: P40348
Structure
PDB: 

Position
X:567643..568704
Genome map
AA seq 353 aa AA seqDB search
MFEGFGPNKKRKISKLAAEQSLAQQPWVEKYRPKNLDEVTAQDHAVTVLKKTLKSANLPH
MLFYGPPGTGKTSTILALTKELYGPDLMKSRILELNASDERGISIVREKVKNFARLTVSK
PSKHDLENYPCPPYKIIILDEADSMTADAQSALRRTMETYSGVTRFCLICNYVTRIIDPL
ASRCSKFRFKALDASNAIDRLRFISEQENVKCDDGVLERILDISAGDLRRGITLLQSASK
GAQYLGDGKNITSTQVEELAGVVPHDILIEIVEKVKSGDFDEIKKYVNTFMKSGWSAASV
VNQLHEYYITNDNFDTNFKNQISWLLFTTDSRLNNGTNEHIQLLNLLVKISQL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaagggtttggtccaaataaaaagcgtaagatatcaaagttagccgcagagcaa
tcattggcacaacaaccctgggttgagaaatacaggcccaaaaacctagatgaagtgaca
gctcaagatcatgccgttactgttttgaagaaaaccttaaagtcagctaatctaccacat
atgttgttttatggtcccccaggaactggtaaaacgtctaccattttagcgctaacaaaa
gaattatatggacccgacttgatgaaatcaagaatattggagttgaacgcttctgacgaa
cgtggtatctctattgtaagagaaaaggtaaaaaattttgcaagattgactgtatccaag
cctagcaaacatgacttggagaactatccgtgcccaccgtataagatcattattctcgat
gaggccgattcaatgactgccgatgcacagagtgcattacgtagaacaatggaaacctat
tcaggagtaacaagattctgtttgatttgtaattatgtgacaagaattattgacccgcta
gcgtcccgttgttccaaatttagattcaaagccctagacgcaagtaatgccattgaccgt
ttgaggtttatcagcgaacaagaaaatgttaaatgtgatgatggagttttggaaaggatc
ttggacatttcggcaggtgacttgagaagaggcattacattattacaatccgcttccaag
ggggcgcaatacttgggtgatggtaaaaacataacttctacccaagtggaagaattagct
ggtgtggtacctcatgacattctaatagaaattgttgaaaaagtcaaaagtggtgatttt
gatgagattaagaaatacgtcaatacgtttatgaaaagcggttggtctgctgcgtcagta
gttaaccaactacatgaatattacatcaccaacgataactttgatacgaacttcaaaaat
caaatatcttggttgctgtttactacggattccagattaaacaacggaacgaacgagcac
atccaattattaaacttattggttaaaatatcccaactctaa

DBGET integrated database retrieval system