KEGG   Saccharomyces cerevisiae (budding yeast): YJR069CHelp
Entry
YJR069C           CDS       T00005                                 

Gene name
HAM1
Definition
(RefSeq) nucleoside triphosphate pyrophosphohydrolase HAM1
  KO
K01519  inosine triphosphate pyrophosphatase [EC:3.6.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00230  Purine metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YJR069C (HAM1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     YJR069C (HAM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-GeneID: 853532
NCBI-ProteinID: NP_012603
SGD: S000003830
UniProt: P47119
Position
X:complement(568806..569399)
Genome map
AA seq 197 aa AA seqDB search
MSNNEIVFVTGNANKLKEVQSILTQEVDNNNKTIHLINEALDLEELQDTDLNAIALAKGK
QAVAALGKGKPVFVEDTALRFDEFNGLPGAYIKWFLKSMGLEKIVKMLEPFENKNAEAVT
TICFADSRGEYHFFQGITRGKIVPSRGPTTFGWDSIFEPFDSHGLTYAEMSKDAKNAISH
RGKAFAQFKEYLYQNDF
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaacgaaattgtatttgtcactggcaatgccaacaagttaaaggaagtgcag
tcgattttgactcaagaggtcgacaacaacaacaaaaccatccacttaatcaatgaggcc
ttagacctggaagaattgcaggacacggatctgaatgccattgcgttagctaagggaaag
caagctgttgcggccttgggtaagggtaagccagtgtttgtggaagacactgcgttgaga
tttgacgaatttaacggtctaccaggtgcttatataaaatggtttttaaagagcatggga
ttggaaaaaattgtgaaaatgttggaaccctttgaaaataaaaacgctgaagcagttacc
accatttgttttgctgattctcggggtgaatatcacttctttcaaggtattacaagaggc
aagatcgttccaagccggggacccactacattcggctgggattcaatttttgaacctttt
gatagtcatggactgacttacgcagagatgagcaaagacgcaaagaatgctatttctcat
cgtggtaaagccttcgctcagtttaaagagtacttgtatcaaaatgacttttag

DBGET integrated database retrieval system