KEGG   Saccharomyces cerevisiae (budding yeast): YJR070CHelp
Entry
YJR070C           CDS       T00005                                 

Gene name
LIA1, MMD1
Definition
(RefSeq) Lia1p
  KO
K06072  deoxyhypusine monooxygenase [EC:1.14.99.29]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YJR070C (LIA1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.29  deoxyhypusine monooxygenase
     YJR070C (LIA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEAT_2 HEAT_PBS HEAT DUF5635
Motif
Other DBs
NCBI-GeneID: 853534
NCBI-ProteinID: NP_012604
SGD: S000003831
UniProt: P47120
Position
X:complement(569621..570598)
Genome map
AA seq 325 aa AA seqDB search
MSTNFEKHFQENVDECTLEQLRDILVNKSGKTVLANRFRALFNLKTVAEEFATKPEEAKK
AIEYIAESFVNDKSELLKHEVAYVLGQTKNLDAAPTLRHVMLDQNQEPMVRHEAAEALGA
LGDKDSLDDLNKAAKEDPHVAVRETCELAINRINWTHGGAKDKENLQQSLYSSIDPAPPL
PLEKDATIPELQALLNDPKQPLFQRYRAMFRLRDIGTDEAILALATGFSAESSLFKHEIA
YVFGQIGSPAAVPSLIEVLGRKEEAPMVRHEAAEALGAIASPEVVDVLKSYLNDEVDVVR
ESCIVALDMYDYENSNELEYAPTAN
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtctactaactttgaaaaacatttccaagaaaacgtcgatgaatgcactctagagcaa
ctaagggacatcttagtcaacaagtccggcaaaacagttttggccaacagatttagagct
ctgttcaacttaaagactgttgctgaagaatttgccactaagccagaggaagccaaaaag
gccatcgaatacattgccgaatccttcgtcaatgacaagtctgagttgttgaagcacgaa
gtggcctacgtgttgggtcaaaccaagaacttggacgctgctccaactttaagacacgtt
atgttagatcaaaatcaagaaccaatggtgagacacgaagccgctgaggctttgggtgcc
ctaggtgacaaggattcgttggatgacctaaataaggctgctaaggaggatccacacgtt
gctgtgagagaaacctgtgaactggccattaacagaatcaactggacccatggaggtgcc
aaggataaggaaaacttgcaacaatccctatactcgagtattgacccagccccacctcta
ccattagaaaaggatgctaccatcccagaactacaggccttattgaatgatcctaagcaa
cctttgttccaaagatacagagccatgttcagactgagagatatcggtactgatgaagca
atcctggccttggccactggtttcagtgcagaatcctcccttttcaagcatgaaatcgcc
tacgtcttcggtcaaataggtagtccggctgctgtcccaagtttgattgaagttttgggc
agaaaggaagaagctccaatggttaggcatgaagctgctgaagccttgggtgccattgct
tctccagaagttgtcgacgtcttgaaatcttacctcaacgatgaagtcgatgtcgtcaga
gaatcttgtatcgttgcgctagatatgtatgattacgaaaacagcaacgaactagaatat
gctccaactgctaattag

DBGET integrated database retrieval system