KEGG   Saccharomyces cerevisiae (budding yeast): YJR073CHelp
Entry
YJR073C           CDS       T00005                                 

Gene name
OPI3, PEM2
Definition
(RefSeq) bifunctional phosphatidyl-N-methylethanolamine N-methyltransferase/phosphatidyl-N-dimethylethanolamine N-methyltransferase
  KO
K00551  phosphatidylethanolamine/phosphatidyl-N-methylethanolamine N-methyltransferase [EC:2.1.1.17 2.1.1.71]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00564  Glycerophospholipid metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
Module
sce_M00091  Phosphatidylcholine (PC) biosynthesis, PE => PC
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    YJR073C (OPI3)
Enzymes [BR:sce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.17  phosphatidylethanolamine N-methyltransferase
     YJR073C (OPI3)
    2.1.1.71  phosphatidyl-N-methylethanolamine N-methyltransferase
     YJR073C (OPI3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEMT
Motif
Other DBs
NCBI-GeneID: 853536
NCBI-ProteinID: NP_012607
SGD: S000003834
UniProt: P05375
Position
X:complement(572315..572935)
Genome map
AA seq 206 aa AA seqDB search
MKESVQEIIQQLIHSVDLQSSKFQLAIVCTMFNPIFWNIVARMEYHKHSLTKMCGGARKG
CYMLAATIFSLGIVRDMVYESALREQPTCSLITGENWTKLGVALFGLGQVLVLSSMYKLG
ITGTYLGDYFGILMDERVTGFPFNVSNNPMYQGSTLSFLGIALYKGKPAGLVVSAVVYFM
YKIALRWEEPFTAMIYANRDKAKKNM
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagtcagtccaagagatcatccagcaactcatccacagtgtcgatttacagtct
tccaagttccagctggccattgtgtgcacgatgttcaatcctatcttttggaacatcgtt
gcaagaatggaataccacaagcattctctcaccaagatgtgtggtggggccagaaagggc
tgttacatgttggcggcgaccatattttcgctaggtatcgtcagagacatggtgtacgag
tctgcattgcgtgaacagcctacgtgttctctgatcacgggcgagaactggaccaagctg
ggtgtggctctctttggtttggggcaagtgcttgttttgagttccatgtacaagctgggt
atcacagggacgtacttgggtgactatttcggcatcctgatggatgagagagtcaccggc
ttccccttcaacgtttccaacaaccccatgtaccagggttccactttgtccttcttgggc
atagccctttacaaaggaaagcctgcggggctggttgtttctgccgtagtttacttcatg
tacaagatcgctcttcgttgggaagaaccttttactgccatgatctacgctaaccgtgat
aaggccaaaaagaatatgtaa

DBGET integrated database retrieval system