KEGG   Saccharomyces cerevisiae (budding yeast): YJR074WHelp
Entry
YJR074W           CDS       T00005                                 

Gene name
MOG1
Definition
(RefSeq) Ran GTPase-binding protein MOG1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mog1
Motif
Other DBs
NCBI-GeneID: 853537
NCBI-ProteinID: NP_012608
SGD: S000003835
UniProt: P47123
Structure
PDB: 

Position
X:573095..573751
Genome map
AA seq 218 aa AA seqDB search
MKIEKASHISQPVQLSTCTLIDTYPGHQGSMNNKEVELYGGAITTVVPPGFIDASTLREV
PDTQEVYVNSRRDEEEFEDGLATNESIIVDLLETVDKSDLKEAWQFHVEDLTELNGTTKW
EALQEDTVQQGTKFTGLVMEVANKWGKPDLAQTVVIGVALIRLTQFDTDVVISINVPLTK
EEASQASNKELPARCHAVYQLLQEMVRKFHVVDTSLFA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgaaaaggcttctcatatttcacaaccggtgcaactttccacatgcactctc
attgacacctaccctggtcatcaaggaagcatgaacaacaaggaagtcgaattatacggc
ggcgccatcactactgtcgtcccacctgggtttatagacgcttctactctaagagaagtc
cccgatacacaggaggtgtacgtcaattcccgtcgcgatgaagaagaattcgaagatgga
ctagccaccaatgaaagcattatcgtggatctcttggagacggtcgacaagagcgatctg
aaggaggcttggcagttccacgtggaagacctgacggagttgaacgggaccaccaaatgg
gaagctttacaagaagacactgttcagcaaggaaccaagttcaccggactcgttatggaa
gtagcaaataagtggggaaaaccagatctggcacagaccgttgtcatcggcgtagcgttg
atcagattaacccagtttgacacggatgtggtcatctccattaatgtacctttgacaaag
gaggaggcgtcgcaagcaagcaacaaagagttgcctgcaagatgtcatgctgtttaccaa
ttgttgcaagaaatggtacggaagtttcacgttgtggacacgtcgctgtttgcttaa

DBGET integrated database retrieval system