KEGG   Saccharomyces cerevisiae (budding yeast): YJR076CHelp
Entry
YJR076C           CDS       T00005                                 

Gene name
CDC11, PSL9
Definition
(RefSeq) septin CDC11
  KO
K16945  cell division control protein 11
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sce04812]
    YJR076C (CDC11)
Cytoskeleton proteins [BR:sce04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 3
     YJR076C (CDC11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Septin MMR_HSR1 Dynamin_N ABC_tran AIG1 RsgA_GTPase IIGP Roc AAA_29 FeoB_N G-alpha cobW
Motif
Other DBs
NCBI-GeneID: 853539
NCBI-ProteinID: NP_012610
SGD: S000003837
UniProt: P32458
Structure
PDB: 

Position
X:complement(575354..576601)
Genome map
AA seq 415 aa AA seqDB search
MSGIIDASSALRKRKHLKRGITFTVMIVGQSGSGRSTFINTLCGQQVVDTSTTILLPTDT
STEIDLQLREETVELEDDEGVKIQLNIIDTPGFGDSLDNSPSFEIISDYIRHQYDEILLE
ESRVRRNPRFKDGRVHCCLYLINPTGHGLKEIDVEFIRQLGSLVNIIPVISKSDSLTRDE
LKLNKKLIMEDIDRWNLPIYNFPFDEDEISDEDYETNMYLRTLLPFAIIGSNEVYEMGGD
VGTIRGRKYPWGILDVEDSSISDFVILRNALLISHLHDLKNYTHEILYERYRTEALSGES
VAAESIRPNLTKLNGSSSSSTTTRRNTNPFKQSNNINNDVLNPASDMHGQSTGENNETYM
TREEQIRLEEERLKAFEERVQQELLLKRQELLQREKELREIEARLEKEAKIKQEE
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaataattgacgcatcttctgcattaagaaaaagaaagcatttgaaaagaggt
ataaccttcactgtgatgatcgtgggccagtccggatctggtagatcgacttttataaat
actttgtgcggtcagcaagttgtagacacttcgacgacaatcttgttacccacagatacg
tccacagaaatagacttacaattgagagaggagacggtcgaattagaagatgatgaaggt
gtcaagattcaacttaatatcatcgatactccgggattcggtgattctctcgacaattct
ccatctttcgaaatcatttccgactacattcgccaccaatatgatgaaatcttattggaa
gaaagtcgtgtgagaagaaacccaagatttaaggacggcagagttcattgttgtctttac
ttaatcaacccaactggccacggtttaaaagagattgatgtggaattcatcagacagttg
ggatccttagttaacatcatccctgtgatcagcaaatcagattccttgacaagagatgaa
ctgaaactgaataaaaaattgatcatggaggatatcgacagatggaacttgccaatttat
aatttccctttcgatgaagatgaaatatcagacgaagattacgaaaccaatatgtaccta
cgtacacttctaccttttgctattattggatccaatgaagtttacgaaatgggcggcgat
gttgggacaattcgtggcagaaagtatccatggggcatactggacgtggaagattcatcg
atctctgattttgttatcttaaggaatgcgttattgatctctcatttacatgacttgaaa
aactacacacatgagatattatatgaaagatatagaaccgaggcattatcaggtgaatct
gtcgcggcagaatccatacgtccaaatctgacaaaattgaatggttcgtcgtcatcgtcc
accacaacaaggagaaacacaaatcccttcaagcaaagtaataatattaataacgatgtt
ctcaacccagcatccgatatgcacgggcaaagcactggcgaaaataacgaaacctacatg
acacgtgaggagcaaatacggttagaagaagagcgactaaaggcatttgaggagagagtt
cagcaagaactgctgttgaaaagacaagaactgttgcaaagagaaaaggaattaagagaa
attgaagccaggttggaaaaagaggcgaaaatcaaacaggaagaatga

DBGET integrated database retrieval system