KEGG   Saccharomyces cerevisiae (budding yeast): YJR077CHelp
Entry
YJR077C           CDS       T00005                                 

Gene name
MIR1
Definition
(RefSeq) Mir1p
  KO
K15102  solute carrier family 25 (mitochondrial phosphate transporter), member 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YJR077C (MIR1)
   04147 Exosome [BR:sce04147]
    YJR077C (MIR1)
Transporters [BR:sce02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   YJR077C (MIR1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YJR077C (MIR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 853540
NCBI-ProteinID: NP_012611
SGD: S000003838
UniProt: P23641
Position
X:complement(577255..578190)
Genome map
AA seq 311 aa AA seqDB search
MSVSAAPAIPQYSVSDYMKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSF
KQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMG
SAAMAEFLADIALCPLEATRIRLVSQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQ
IPYNIAKFLVFERASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLS
KVNKTKKAPGQSTVGLLAQLAKQLGFFGSFAGLPTRLVMVGTLTSLQFGIYGSLKSTLGC
PPTIEIGGGGH
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgtctgctgctcctgctattccacagtactctgtctctgactacatgaaattc
gccctagccggcgccatagggtgcgggtcgactcactccagtatggtcccgatcgatgtc
gttaagacgagaatccaactggaacctaccgtgtacaacaagggtatggtcggctctttc
aagcaaatcatcgccggagaaggtgctggtgcgttgttgaccgggtttggtcctactttg
ttgggttactctatccaaggtgccttcaagttcggtggttacgaagtgttcaagaagttc
ttcattgacaacttgggttacgataccgcctctcgctacaagaactctgtttacatgggt
tctgctgccatggccgaattcttggcagacattgccttgtgtcccctagaagccactaga
atcagattggtctcccaaccacagttcgctaatggactcgtcggagggttttccagaatt
ttgaaagaagaaggtatcggctctttctacagtgggttcactccaattttgttcaagcaa
attccttacaacattgctaaattcttggtctttgaacgtgcctccgagttctactacggg
ttcgccggtccaaaagaaaaattgtcctctacttccactactttgttgaatttgctttcc
ggtttgactgctggtttggccgctgccattgtttcccagccagcagacactctgttgtcc
aaggtcaacaagactaagaaggctcctggccaatccacagtcggtttgttggctcagttg
gccaaacagttaggatttttcggttcctttgctgggttgcctactcgtttggtcatggtt
ggtaccttgacctccttgcaatttggtatttatggttctttaaagagcactttgggttgc
ccaccaaccattgaaattggtggtggtggtcattag

DBGET integrated database retrieval system