KEGG   Saccharomyces cerevisiae (budding yeast): YJR080CHelp
Entry
YJR080C           CDS       T00005                                 

Gene name
AIM24, FMP26
Definition
(RefSeq) Aim24p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIM24
Motif
Other DBs
NCBI-GeneID: 853543
NCBI-ProteinID: NP_012614
SGD: S000003841
UniProt: P47127
Position
X:complement(580432..581616)
Genome map
AA seq 394 aa AA seqDB search
MISPRVNTRVWQRSISLLSPQAAKTESNVVTKERTYIENLSKDIATSRFRLVDENGKIAS
ITVQPDIPICIKKDCLVSIHNLNHLSLSYKWLNFWSNLIKFRSFKSSLFHRIIGSSVLEI
LAAPNFQTSRRPFDSSRSLSVLNLTGTKDWNVFGKDSIIAFEQNSSLEIKSPIFPSARSL
VSNSSKSQLPRKFQILNGRGNVLVCGGGLVYSIELIDESDKILVNSRNILAINGQSQLDI
ANSVERQELHVEGAYVGDSSNDTVAPKFIKNQTLKSAYGHTVQFFKRMRSWIRNQYEKRY
IYGVDSYFMKIKGPRTILIQTHEMTTSKDNILTKLTSKGHVKKSNVNDNGVNLEKQVAND
VNSKIIELANRPSLFIATVSQDGRVDFQSTSKFT
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgataagcccaagggtgaatactcgagtttggcagagatcaatttctcttttgagccca
caagcggccaagacggagagtaatgtcgtaactaaagaaaggacatatatcgagaactta
agcaaggatattgcgacttcccgtttcaggctagtagacgaaaatggtaaaattgcatct
atcactgttcaaccagatattccaatttgtatcaaaaaggattgcctagtttccattcac
aatttgaaccatttatccctttcctataaatggctgaatttttggtcaaacctgattaaa
tttcgttcattcaaatcttcattgtttcatagaattattggatcctccgttttagaaatt
ctggctgccccaaactttcaaacatcgagaagacctttcgattcttcaagaagcttgtcc
gtactgaatttgaccgggacaaaggattggaatgtatttggcaaggattcaattatcgca
tttgaacagaactccagtctggaaatcaaatcgcctatctttccctctgcaaggtcttta
gtctcgaactcatcaaaatcacaactaccacggaaatttcaaattctgaatgggagagga
aatgtgttagtatgtggaggtgggttggtatattcaattgagttaattgatgaaagcgac
aaaattctggttaattccagaaacattttggccatcaacggccaaagtcaattggatatt
gcaaattcagtggagagacaagagttacacgtggaaggcgcgtacgtcggagattcaagt
aatgatacggtggcacctaaattcattaagaaccaaacgctaaaatctgcttacggacat
actgttcaatttttcaaaagaatgcgcagttggatccgtaaccagtacgaaaaaagatac
atttatggtgtcgactcgtactttatgaagattaaaggtccaagaacaatattgattcaa
acgcatgaaatgacaacatccaaagataatattctaactaaactaacgtccaagggccac
gttaagaagagcaacgtgaatgataacggtgtcaatttagagaaacaagtggctaacgat
gtaaattcaaagatcattgagcttgccaacagaccctcactgtttattgcgaccgtctcg
caagatgggagggttgattttcaaagtacttcgaagttcacataa

DBGET integrated database retrieval system