KEGG   Saccharomyces cerevisiae (budding yeast): YJR082CHelp
Entry
YJR082C           CDS       T00005                                 

Gene name
EAF6
Definition
(RefSeq) Eaf6p
  KO
K11344  chromatin modification-related protein EAF6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YJR082C (EAF6)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     YJR082C (EAF6)
    HBO1 complex
     YJR082C (EAF6)
    MOZ/MORF complex
     YJR082C (EAF6)
    NuA4 complex
     YJR082C (EAF6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NuA4
Motif
Other DBs
NCBI-GeneID: 853544
NCBI-ProteinID: NP_012615
SGD: S000003842
UniProt: P47128
Structure
PDB: 

Position
X:complement(581914..582255)
Genome map
AA seq 113 aa AA seqDB search
MTDELKSYEALKAELKKSLQDRREQEDTFDNLQQEIYDKETEYFSHNSNNNHSGHGGAHG
SKSHYSGNIIKGFDTFSKSHHSHADSAFNNNDRIFSLSSATYVKQQHGQSQND
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgactgatgagctgaaaagttatgaagcattgaaagcggaactaaaaaagtccctccaa
gatagaagagagcaagaagatacctttgacaacttacaacaagagatatatgataaagag
accgagtatttctcacacaatagtaataacaaccattcaggtcatgggggagcccatggg
tcaaaatcacactattctggtaacatcataaaagggtttgataccttctccaagtcacac
cacagccatgcagattctgcattcaataacaatgatcgtattttttcattaagtagtgct
acgtacgtgaagcagcagcatggccaatcacaaaacgactaa

DBGET integrated database retrieval system