KEGG   Saccharomyces cerevisiae (budding yeast): YJR083CHelp
Entry
YJR083C           CDS       T00005                                 

Gene name
ACF4
Definition
(RefSeq) Acf4p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tropomyosin_1 DUF3634 Cep57_CLD_2
Motif
Other DBs
NCBI-GeneID: 853545
NCBI-ProteinID: NP_012616
SGD: S000003843
UniProt: P47129
Position
X:complement(582608..583537)
Genome map
AA seq 309 aa AA seqDB search
MSEDQRVISQPIELHKLSIVDKHSQGQQQQPHQKQHEVQPESKSPRVTTPLKPKRLAIPI
SSPQRSTTNQSPVSDHASPISTDQDLIYKLAAKHREINELSFKLEVAQKELKQLELQFKD
TLPRNGQQKLGNQNPSEYLSTFTKRIQQTFVDVNNSPNMLKGKKSINDFFSKPNNNVNSN
INNTLPNRKPNPPPNRSQRMQNIAPSRSSESTPTSGPPLLPPRNTMKNANTTATAGENTP
FLQRILNKFNQMNMEEDEFDDLLEKRKSKKDHYYIKENLGYEYDEVRSEDEDDEEFEPMG
DIPVHLFKR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagaccagcgtgtaattagtcaaccaattgaattacataagctgtcgattgtc
gataaacactcccaaggacagcagcaacagccgcatcaaaaacaacatgaagtgcagcct
gaatcaaaatcaccaagggttacgacacctttaaagcccaaaagacttgctatacctata
tcaagtccgcaaagatctacgacaaatcagtcacccgtgagcgaccacgcaagtccgatt
tcaacagaccaagatttaatatataaattagctgcaaaacacagagaaatcaatgaactt
agtttcaaattagaggtcgcccaaaaagaattaaaacaattagagttacagttcaaagat
acactgccccgaaatggacaacagaaattaggtaaccagaacccaagtgaatacctctct
acttttaccaaaagaattcaacagacatttgtggacgtaaataattcaccaaatatgctc
aagggaaaaaagagtataaacgatttttttagtaagcccaataataatgttaatagcaac
ataaataacactctacccaatcgtaaaccgaaccctccgcctaatcggtcacaacgtatg
caaaatattgctccaagccgtagttcagaatcaactccaacatcgggtcctcccttgcta
cccccaaggaatactatgaagaatgctaataccacggcaactgctggggagaacacacca
ttcttacaaagaatacttaacaaattcaatcaaatgaatatggaagaggacgaattcgat
gaccttttggaaaagaggaaaagtaagaaagatcactattacataaaagaaaatttgggt
tacgaatacgatgaagtacgcagtgaagacgaggatgatgaagagtttgaacccatgggt
gacatacccgttcatttatttaaaaggtag

DBGET integrated database retrieval system