KEGG   Saccharomyces cerevisiae (budding yeast): YJR084WHelp
Entry
YJR084W           CDS       T00005                                 

Gene name
CSN12
Definition
(RefSeq) hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 853546
NCBI-ProteinID: NP_012617
SGD: S000003844
UniProt: P47130
Position
X:583733..585004
Genome map
AA seq 423 aa AA seqDB search
MDVDIGCYFEEKRYDDKLLDFIRYDVKTPKKTKYILQRPTATDEESVRLQRFYQLGVDLK
LKYSKRRSLKKQGRIKNATEELLRLANEQLKLFNRIVERETNWIIYPLWVMAKQLIRLAN
ESSELNKDSIEECGRTIHRSFTICLNDRNPRLNENKKIGCYMFANLEFSIYHRLSNKDMI
KNLVKVLESRVNARDIPPLNKSLAMEHKSQVVLYNYYLGQYYGCLENDHERGFFHLNEAL
LQCPMLYVESTGKFVLQGQMEKIMILLVPLALLTKRLYPHWDHPVIAGVITRSKRLSQVY
PTLVRSVISGNLSLYEATAASHERFFLSQGLHVVITLLREVVFTRLVQRCWQWGNDRKSI
MPLKILLATKQHDSSANEDEEEQLDALECRLASAIASGLLRAYLSHSNRCIVFSKKEPFP
HSK
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggatgttgatataggatgttattttgaagagaaacgctatgacgacaaactgttagac
ttcatcagatatgacgttaaaacacctaaaaagactaaatatatactacaaaggcctacg
gcgacagatgaagagagtgtacgattacaaaggttttaccaattaggagtagatctaaaa
ttgaagtattccaagcggaggtcattgaagaagcaagggcggatcaagaatgctactgag
gaattgctgcgattagccaatgaacagttgaaacttttcaacagaatagtagaaagagaa
accaattggataatttatccgctgtgggtaatggctaaacaattaattcgtctggcaaac
gaatctagtgaacttaataaagactcaattgaggaatgtggacgcactatccatagaagc
tttactatatgcctcaatgataggaacccaagattgaatgaaaataaaaaaatcgggtgt
tatatgtttgctaatctagagttttccatctaccatcggttaagtaataaagatatgatt
aaaaatttagtgaaagtcctcgagagcagagtgaacgcccgggatataccaccgttgaat
aaaagcctggcaatggaacataagtctcaagtggtgttgtataattattatctaggtcaa
tactacggatgtctggaaaacgatcacgaacgcgggttcttccatttaaatgaagcatta
ttgcaatgtccaatgctatatgtggaatctaccggcaagttcgtcttacagggccaaatg
gaaaagataatgatactgctggttccgcttgctcttttaactaaaaggttgtaccctcac
tgggatcatccagtaatcgccggagtaattactaggagtaagcgcttaagtcaagtttat
ccgacattagtgcgtagcgtaatctcagggaacctgtcactgtacgaggctaccgcagca
agccatgaaagatttttcctttcgcaaggattgcatgtcgtcatcacattacttcgagag
gtggtcttcactcggttggtacaacgatgttggcaatgggggaatgatcggaaaagtatc
atgcccttgaaaattcttctggcaacaaaacaacacgatagttctgccaatgaggacgaa
gaggagcagttggatgccctagaatgccgtctagcaagtgctatagcaagtgggcttttg
cgtgcttatctttctcactccaaccgctgcatcgttttcagtaagaaggagccctttccc
catagcaaatga

DBGET integrated database retrieval system