KEGG   Saccharomyces cerevisiae (budding yeast): YJR085CHelp
Entry
YJR085C           CDS       T00005                                 

Definition
(RefSeq) hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tmemb_14 Aim19 COX4_pro
Motif
Other DBs
NCBI-GeneID: 853547
NCBI-ProteinID: NP_012618
SGD: S000003845
UniProt: P47131
Position
X:complement(585120..585437)
Genome map
AA seq 105 aa AA seqDB search
MEHPAYTLSLLTTAGGLMGYYRKGSIPSLVSGLVFGSVYGIAGYLLHMNRDGGLEMALGA
STLLLGAGVIRGMPSRFTKPVPVVLTALGGLGSYYYYNKYKEFYP
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggaacatccagcatatacattgagtcttttgactacagccggtggccttatgggatac
taccgtaagggctccattccatctctagtatctggcttagtattcggtagtgtatatggg
attgccggttacttgctacatatgaatagagatggtgggctcgaaatggcattgggtgca
tcgaccttactacttggtgctggtgtcataagaggcatgccttccaggttcactaaacct
gtccctgtcgttttgacagctttgggtgggctcggcagttactactattataacaaatac
aaggaattttacccttag

DBGET integrated database retrieval system