KEGG   Saccharomyces cerevisiae (budding yeast): YJR086WHelp
Entry
YJR086W           CDS       T00005                                 

Gene name
STE18
Definition
(RefSeq) Ste18p
  KO
K07973  guanine nucleotide-binding protein subunit gamma, other
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YJR086W (STE18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:sce04031]
    YJR086W (STE18)
GTP-binding proteins [BR:sce04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    YJR086W (STE18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G-gamma Peptidase_C3
Motif
Other DBs
NCBI-GeneID: 853548
NCBI-ProteinID: NP_012619
SGD: S000003846
UniProt: P18852
Position
X:586068..586400
Genome map
AA seq 110 aa AA seqDB search
MTSVQNSPRLQQPQEQQQQQQQLSLKIKQLKLKRINELNNKLRKELSRERITASNACLTI
INYTSNTKDYTLPELWGYPVAGSNHFIEGLKNAQKNSQMSNSNSVCCTLM
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagttcaaaactctccacgcttacaacaacctcaggaacagcaacagcaacag
caacagctttccttaaagataaaacaattgaagttaaaaagaatcaacgaacttaacaat
aaactgaggaaagaactcagccgtgaaagaattactgcttcaaatgcatgtcttacaata
ataaactatacctcgaatacaaaagattatacattaccagaactatggggctaccccgta
gcaggatcaaatcattttatagagggtttgaaaaatgctcaaaaaaatagccaaatgtca
aactcaaatagtgtttgttgtacgcttatgtaa

DBGET integrated database retrieval system